P43192 · NU6M_ALLAL
- ProteinNADH-ubiquinone oxidoreductase chain 6
- GeneMT-ND6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids173 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Catalytic activity
- a ubiquinone + NADH + 5 H+(in) = a ubiquinol + NAD+ + 4 H+(out)
a ubiquinone RHEA-COMP:9565 + CHEBI:57945 + 5 H+ (in)CHEBI:15378= a ubiquinol RHEA-COMP:9566 + CHEBI:57540 + 4 H+ (out)CHEBI:15378
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial membrane | |
Molecular Function | NADH dehydrogenase (ubiquinone) activity |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADH-ubiquinone oxidoreductase chain 6
- EC number
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Neoaves > Charadriiformes > Alcidae > Alle
Accessions
- Primary accessionP43192
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1-21 | Helical | ||||
Sequence: MTYFVLFLGLCFVLGGLAVAS | ||||||
Transmembrane | 27-47 | Helical | ||||
Sequence: YGVVGLVLASIAGCGWLLSLG | ||||||
Transmembrane | 48-68 | Helical | ||||
Sequence: VSFVSLVLFMVYLGGMLVVFV | ||||||
Transmembrane | 87-107 | Helical | ||||
Sequence: VVGYGVSLITVLVVGVVVGGF | ||||||
Transmembrane | 113-133 | Helical | ||||
Sequence: FGVITVDSVGMFSVRLDFGGV | ||||||
Transmembrane | 139-159 | Helical | ||||
Sequence: CGVGMFLVAGWGLLLTLFVVL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000118235 | 1-173 | NADH-ubiquinone oxidoreductase chain 6 | |||
Sequence: MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASIAGCGWLLSLGVSFVSLVLFMVYLGGMLVVFVYSVSLAADPFPEAWGDWRVVGYGVSLITVLVVGVVVGGFVEYWDFGVITVDSVGMFSVRLDFGGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLTRGAIRAV |
Structure
Sequence
- Sequence statusComplete
- Length173
- Mass (Da)18,338
- Last updated1995-11-01 v1
- Checksum1A41EF4686F7378A