P43157 · CYSP_SCHJA
- ProteinCathepsin B-like cysteine proteinase
- GeneCATB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids342 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Thiol protease. Has a role as a digestive enzyme.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 118 | |||||
Sequence: C | ||||||
Active site | 288 | |||||
Sequence: H | ||||||
Active site | 308 | |||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | lysosome | |
Molecular Function | cysteine-type endopeptidase activity | |
Biological Process | proteolysis involved in protein catabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCathepsin B-like cysteine proteinase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Platyhelminthes > Trematoda > Digenea > Strigeidida > Schistosomatoidea > Schistosomatidae > Schistosoma
Accessions
- Primary accessionP43157
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-17 | |||||
Sequence: MLKIAVYIVSLFTFLEA | ||||||
Propeptide | PRO_0000026170 | 18-89 | Activation peptide | |||
Sequence: HVTTRNNQRIEPLSDEMISFINEHPDAGWKADKSDRFHSLDDARILMGARKEDAEMKRNRRPTVDHHDLNVE | ||||||
Chain | PRO_0000026171 | 90-342 | Cathepsin B-like cysteine proteinase | |||
Sequence: IPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGGQSAELSALDLISCCKDCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPYPFPKCEHHTKGKYPACGTKIYKTPQCKQTCQKGYKTPYEQDKHYGDESYNVQNNEKVIQRDIMMYGPVEAAFDVYEDFLNYKSGIYRHVTGSIVGGHAIRIIGWGVEKRTPYWLIANSWNEDWGEKGLFRMVRGRDECSIESDVVAGLIKT | ||||||
Disulfide bond | 103↔132 | |||||
Sequence: CKSISQIRDQSRCGSCWAFGAVEAMTDRIC | ||||||
Disulfide bond | 115↔159 | |||||
Sequence: CGSCWAFGAVEAMTDRICIQSGGGQSAELSALDLISCCKDCGDGC | ||||||
Disulfide bond | 151↔217 | |||||
Sequence: CCKDCGDGCQGGFPGVAWDYWVKRGIVTGGSKENHTGCQPYPFPKCEHHTKGKYPACGTKIYKTPQC | ||||||
Disulfide bond | 152↔155 | |||||
Sequence: CKDC | ||||||
Disulfide bond | 188↔221 | |||||
Sequence: CQPYPFPKCEHHTKGKYPACGTKIYKTPQCKQTC | ||||||
Disulfide bond | 196↔207 | |||||
Sequence: CEHHTKGKYPAC |
Keywords
- PTM
Expression
Tissue specificity
Intestine (gut).
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length342
- Mass (Da)38,796
- Last updated1995-11-01 v1
- Checksum81BA89CD61A68B4C