P42634 · TKSIA_AEDAE
- ProteinProsialokinin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Vasodilatory peptide (PubMed:1375258, PubMed:35417706).
Facilitates mosquito blood feeding on vertebrate host (PubMed:35417706).
Induces nitric oxide (NO) release in blood vessels through the activation of the nitric oxide synthase (NOS3) (PubMed:35417706).
Enhances endothelial permeability and induces edema at the site of inoculation in the host (PubMed:35417706, PubMed:35675424).
Induces host smooth muscle contraction (PubMed:1375258, PubMed:8278354).
Down-regulates production of Th1 cytokines, such as IL2 and IFN-gamma (IFNG), in mouse splenocytes (PubMed:10081770).
Up-regulates production of Th2 cytokines, such as IL4 and IL10, in mouse splenocytes (PubMed:10081770).
Promotes recruitment of host leukocytes, especially neutrophils and CD8+ T cells, to the bite site (PubMed:35417706).
Modulates cytokine production by host macrophages (PubMed:35417706).
Modulates populations of monocytes/macrophages, plasmacytoid dendritic cells, B cells, CD4+ T cells, NK and NKT cells, shifting mammalian immunity towards Th2 responses (PubMed:36735632).
Facilitates mosquito blood feeding on vertebrate host (PubMed:35417706).
Induces nitric oxide (NO) release in blood vessels through the activation of the nitric oxide synthase (NOS3) (PubMed:35417706).
Enhances endothelial permeability and induces edema at the site of inoculation in the host (PubMed:35417706, PubMed:35675424).
Induces host smooth muscle contraction (PubMed:1375258, PubMed:8278354).
Down-regulates production of Th1 cytokines, such as IL2 and IFN-gamma (IFNG), in mouse splenocytes (PubMed:10081770).
Up-regulates production of Th2 cytokines, such as IL4 and IL10, in mouse splenocytes (PubMed:10081770).
Promotes recruitment of host leukocytes, especially neutrophils and CD8+ T cells, to the bite site (PubMed:35417706).
Modulates cytokine production by host macrophages (PubMed:35417706).
Modulates populations of monocytes/macrophages, plasmacytoid dendritic cells, B cells, CD4+ T cells, NK and NKT cells, shifting mammalian immunity towards Th2 responses (PubMed:36735632).
(Microbial infection) Promotes Semliki Forest virus infection in the host.
(Microbial infection) Does not affect Zika virus replication in the host.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | immune system process | |
Biological Process | neuropeptide signaling pathway | |
Biological Process | vasodilation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProsialokinin
- Cleaved into 1 chains
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Nematocera > Culicoidea > Culicidae > Culicinae > Aedini > Aedes > Stegomyia
Accessions
- Primary accessionP42634
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Extended probing times when mosquitoes are fed on mouse or chicken but not when fed using an artificial membrane feeder (PubMed:35417706).
Reduced blood-feeding success, determined as the percentage of engorged mosquitoes after 90 or 120 sec, when fed on mouse or chicken but not when fed using an artificial membrane feeder (PubMed:35417706).
No significant effects on blood meal size, fecundity and fertility (PubMed:35417706).
Lower blood perfusion during probing and feeding at the bite site (PubMed:35417706).
Reduced endothelial permeability enhancement at the site of inoculation in the host (PubMed:35417706).
Fewer recruited leukocytes, especially neutrophils and CD8+ T cells, at the site of inoculation in the host (PubMed:35417706).
Fewer B cells in the blood and spleen of the mouse host (PubMed:36735632).
No significant effects on the number of B cells or mast cells at the bite site (PubMed:35417706).
Increased IL10, IFN-gamma (IFNG) and IL6 levels, and reduced IL-1beta (IL1B) levels in macrophages (PubMed:35417706).
More CD11c- monocytes and macrophages in the blood, spleen and bone marrow of the mouse host after mosquito bite with no significant increase in CD11c+ populations (PubMed:36735632).
Altered levels of plasmacytoid dendritic cells in the mouse tissues after mosquito bite (PubMed:36735632).
More CD4+ T cells in the skin, blood, spleen and bone marrow of the mouse host after mosquito bite (PubMed:36735632).
Fewer NKT cells at the bite site (PubMed:36735632).
More NK cells in the skin and blood of the mouse host after mosquito bite (PubMed:36735632).
Reduced blood-feeding success, determined as the percentage of engorged mosquitoes after 90 or 120 sec, when fed on mouse or chicken but not when fed using an artificial membrane feeder (PubMed:35417706).
No significant effects on blood meal size, fecundity and fertility (PubMed:35417706).
Lower blood perfusion during probing and feeding at the bite site (PubMed:35417706).
Reduced endothelial permeability enhancement at the site of inoculation in the host (PubMed:35417706).
Fewer recruited leukocytes, especially neutrophils and CD8+ T cells, at the site of inoculation in the host (PubMed:35417706).
Fewer B cells in the blood and spleen of the mouse host (PubMed:36735632).
No significant effects on the number of B cells or mast cells at the bite site (PubMed:35417706).
Increased IL10, IFN-gamma (IFNG) and IL6 levels, and reduced IL-1beta (IL1B) levels in macrophages (PubMed:35417706).
More CD11c- monocytes and macrophages in the blood, spleen and bone marrow of the mouse host after mosquito bite with no significant increase in CD11c+ populations (PubMed:36735632).
Altered levels of plasmacytoid dendritic cells in the mouse tissues after mosquito bite (PubMed:36735632).
More CD4+ T cells in the skin, blood, spleen and bone marrow of the mouse host after mosquito bite (PubMed:36735632).
Fewer NKT cells at the bite site (PubMed:36735632).
More NK cells in the skin and blood of the mouse host after mosquito bite (PubMed:36735632).
(Microbial infection) RNAi-mediated knockdown results in reduced ability of mosquito saliva to enhance Semliki Forest virus infection in mammalian cells.
(Microbial infection) No significant effects on Zika virus infection in mammalian cells.
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 75 | |||||
Sequence: N → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MNMFITVQIVIVLVLAVLSEAAS | ||||||
Propeptide | PRO_0000344495 | 24-74 | ||||
Sequence: LPTATERKDAMDEGPNQSDEPEGSVADPSTKDDDYSDSLKQDEKYYKVRLL | ||||||
Peptide | PRO_0000460462 | 75-84 | Sialokinin | |||
Sequence: NTGDKFYGLM | ||||||
Modified residue | 84 | Methionine amide | ||||
Sequence: M |
Keywords
- PTM
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 26-61 | Disordered | ||||
Sequence: TATERKDAMDEGPNQSDEPEGSVADPSTKDDDYSDS |
Sequence similarities
Belongs to the tachykinin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length85
- Mass (Da)9,377
- Last updated2008-07-22 v2
- Checksum64152347F70A8A81
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2 | in Ref. 1; AAD17916 | ||||
Sequence: N → K | ||||||
Sequence conflict | 15 | in Ref. 1; AAD17916 | ||||
Sequence: L → F | ||||||
Sequence conflict | 24 | in Ref. 1; AAD17916 | ||||
Sequence: L → F | ||||||
Sequence conflict | 30 | in Ref. 1; AAD16886/AAD16885 | ||||
Sequence: R → T | ||||||
Sequence conflict | 50-51 | in Ref. 1; AAD16886/AAD16885 | ||||
Sequence: DP → NT | ||||||
Sequence conflict | 54 | in Ref. 1; AAD16886/AAD16885 | ||||
Sequence: K → E |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF108099 EMBL· GenBank· DDBJ | AAD17916.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF108100 EMBL· GenBank· DDBJ | AAD16884.1 EMBL· GenBank· DDBJ | mRNA | ||
AF108101 EMBL· GenBank· DDBJ | AAD16885.1 EMBL· GenBank· DDBJ | mRNA | ||
AF108102 EMBL· GenBank· DDBJ | AAD16886.1 EMBL· GenBank· DDBJ | mRNA | ||
CH477189 EMBL· GenBank· DDBJ | EAT48743.1 EMBL· GenBank· DDBJ | Genomic DNA |