P42580 · NKX12_MOUSE
- ProteinNK1 transcription factor-related protein 2
- GeneNkx1-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids305 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
May function in cell specification, particularly in the CNS.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 156-215 | Homeobox | ||||
Sequence: PRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell differentiation | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameNK1 transcription factor-related protein 2
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP42580
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000049290 | 1-305 | NK1 transcription factor-related protein 2 | |||
Sequence: MLAWQDVGAKAAPSHHKISFSVLDILDPQKFTRAALPPVRLAALEAKKSLEEVEAGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSPEARAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSATGSSPGPPVPGALPYQTFPTYPATNVLFPAASFPLTTAANGSPFTPFLGPSYLTPFYAPHL |
Post-translational modification
Phosphorylated by HIPK2 in vitro.
Proteomic databases
Expression
Tissue specificity
Expression detected in adult brain, testis and spleen. In the testis, expressed in the germ cells of the seminiferous epithelium, in elongating spermatids and in spermatozoa. Expressed throughout the brain with highest levels in regions of the cerebral cortex, hippocampus, diencephalon, pons, medulla and cerebellum. In the embryo, expressed in the developing posterior central nervous system. First seen in the ectoderm lateral to the primitive streak, later it encompasses the neural plate. Starting at day 9.5 pc, expressed in distinct areas of spinal cord, hindbrain, midbrain and forebrain.
Developmental stage
In the embryo, expressed at highest levels at day 10 with levels decreasing during further development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 51-158 | Disordered | ||||
Sequence: EEVEAGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSPEARAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRR | ||||||
Compositional bias | 96-112 | Basic and acidic residues | ||||
Sequence: EDAGRAHQPERWQGVHE | ||||||
Region | 210-257 | Disordered | ||||
Sequence: KWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSATGSSPGPPVPGAL |
Sequence similarities
Belongs to the NK-1 homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length305
- Mass (Da)32,013
- Last updated1995-11-01 v1
- ChecksumE02E09A40453FF1B
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 96-112 | Basic and acidic residues | ||||
Sequence: EDAGRAHQPERWQGVHE | ||||||
Sequence conflict | 216 | in Ref. 2; AAF43673 | ||||
Sequence: P → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X75384 EMBL· GenBank· DDBJ | CAA53153.1 EMBL· GenBank· DDBJ | mRNA | ||
AF222443 EMBL· GenBank· DDBJ | AAF43669.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF222443 EMBL· GenBank· DDBJ | AAF43670.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AF222444 EMBL· GenBank· DDBJ | AAF43671.1 EMBL· GenBank· DDBJ | mRNA | ||
AF222445 EMBL· GenBank· DDBJ | AAF43672.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AF223361 EMBL· GenBank· DDBJ | AAF43673.1 EMBL· GenBank· DDBJ | mRNA | ||
AF223362 EMBL· GenBank· DDBJ | AAF43674.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC139757 EMBL· GenBank· DDBJ | AAI39758.1 EMBL· GenBank· DDBJ | mRNA | ||
U58137 EMBL· GenBank· DDBJ | AAB06948.1 EMBL· GenBank· DDBJ | Genomic DNA |