P42287 · GRK_DROME
- ProteinProtein gurken
- Genegrk
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids295 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Critical for defining the anterior-posterior and dorsal-ventral axes of the egg. May signal directly to dorsal follicle cells through the receptor torpedo (top). During oogenesis this signaling pathway instructs follicle cells to follow a dorsal pathway of development rather than the default ventral pathway.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein gurken
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP42287
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Note: Associates with the membranous cortex of yolk granules. Transiently inserted into the cell membrane, and then reinternalized during yolk uptake. cni is required for its transport to the oocyte cell membrane.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 27-247 | Extracellular | ||||
Sequence: SSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIILGSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQRKVRMAH | ||||||
Transmembrane | 248-268 | Helical | ||||
Sequence: IVFSFPVLLMLSSLYVLFAAV | ||||||
Topological domain | 269-295 | Cytoplasmic | ||||
Sequence: FMLRNVPDYRRKQQQLHLHKQRFFVRC |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MMQIPFTRIFKVIFVLSTIVAVTDCC | ||||||
Chain | PRO_0000007607 | 27-295 | Protein gurken | |||
Sequence: SSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIILGSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQRKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC | ||||||
Disulfide bond | 183↔198 | |||||
Sequence: CSEAYNTSFCLNGGHC | ||||||
Glycosylation | 188 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 192↔212 | |||||
Sequence: CLNGGHCFQHPMVNNTVFHSC | ||||||
Glycosylation | 205 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 214↔223 | |||||
Sequence: CVNDYDGERC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in nurse cells and oocyte up to oogenesis stage 7. Specifically accumulates in dorsal anterior corner of the oocyte during stages 9/10, at later stages expression is seen as an anterior ring. In stage 10 ovaries, it is concentrated between the oocyte nucleus and the adjacent oolemma. During vitellogenesis stage it can be detected at the oocyte surface, especially on the microvilli. It is also found at the microvilli covering the apical surface of the follicular epithelium and within follicle cells.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 78-111 | Disordered | ||||
Sequence: EASAQEEADQLHPDTDPNPDSGGQLPNADDSIAA | ||||||
Compositional bias | 124-156 | Polar residues | ||||
Sequence: TDTWLASESSTPITDSETVTTPETVTHTGEPPP | ||||||
Region | 124-175 | Disordered | ||||
Sequence: TDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKE | ||||||
Domain | 179-224 | EGF-like | ||||
Sequence: QMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCA | ||||||
Region | 215-245 | Interaction with cni | ||||
Sequence: VNDYDGERCAYKSWNGDYIYSPPTAQRKVRM |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length295
- Mass (Da)33,280
- Last updated2003-01-17 v2
- Checksum80E993704DE3123B
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 124-156 | Polar residues | ||||
Sequence: TDTWLASESSTPITDSETVTTPETVTHTGEPPP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L22531 EMBL· GenBank· DDBJ | AAA28598.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF223394 EMBL· GenBank· DDBJ | AAF72000.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AE014134 EMBL· GenBank· DDBJ | AAF52675.4 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY051814 EMBL· GenBank· DDBJ | AAK93238.1 EMBL· GenBank· DDBJ | mRNA |