P42282 · TTKA_DROME
- ProteinProtein tramtrack, alpha isoform
- Genettk
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids813 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to a number of sites in the transcriptional regulatory region of ftz. Isoform alpha is required to repress genes that promote the R7 cell fate. Probable repressor of the transcription of the segmentation genes ftz, eve, h, odd, run, and en. May bind to the region 5'-AGGG[CT]GG-3'. Degradation of ttk is directed by binding of sinah or sina, via the adapter molecule phyl which binds to the BTB domain of ttk.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein tramtrack, alpha isoform
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP42282
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000047078 | 1-813 | Protein tramtrack, alpha isoform | |||
Sequence: MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPSPAAAAAGAGATGSESTATTPQLQRIQPYLVPQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSETISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKKNQDEVNACIGLHSLANAAEQQAAQVASTGNLHHQLLLHMAANNSMLNTTDYYQQQQQESPSSAGQFMDDDLELLSLNDQQDKSDEPDHEMVTLADENAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFKNKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLKYLISAAAAGDMHATIYQQQQDHYHRQLAEQLEQQNASFDSRDSSLILPDVKMEHAEDQDAEQEAELSDGGYDASNPAAAAAAMLSLQQDVIIKDEIQISPSPSPTPPASCAVAEGKSLALASTAQTAT | ||||||
Modified residue | 203 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 205 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 206 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 209 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 682 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed both maternally and zygotically. Expressed in preblastoderm embryos, followed by complete decay upon formation of the cellular blastoderm when ftz striped expression is at its peak.
Gene expression databases
Interaction
Subunit
Interacts with CoRest/CG33525, suggesting that it acts by recruiting a CoRest-containing corepressor complex. Interacts with phyl.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P42282 | ebi Q95RJ9 | 2 | EBI-77008, EBI-421390 | |
BINARY | P42282 | phyl Q27934 | 10 | EBI-77008, EBI-77033 | |
BINARY | P42282 | sina P21461 | 4 | EBI-77008, EBI-77019 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 33-98 | BTB | ||||
Sequence: TDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQ | ||||||
Region | 118-148 | Disordered | ||||
Sequence: EVNDDKPSPAAAAAGAGATGSESTATTPQLQ | ||||||
Compositional bias | 171-185 | Polar residues | ||||
Sequence: ANAGNTPTLPVQPSL | ||||||
Region | 171-324 | Disordered | ||||
Sequence: ANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSE | ||||||
Compositional bias | 223-255 | Polar residues | ||||
Sequence: NDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHT | ||||||
Compositional bias | 256-283 | Basic and acidic residues | ||||
Sequence: DDLNESRDSLPSKRSKNSKDHRVVSHHE | ||||||
Compositional bias | 284-324 | Polar residues | ||||
Sequence: DNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSE | ||||||
Compositional bias | 356-390 | Polar residues | ||||
Sequence: TTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQ | ||||||
Region | 356-428 | Disordered | ||||
Sequence: TTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKK | ||||||
Region | 525-585 | Disordered | ||||
Sequence: NAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQ | ||||||
Zinc finger | 610-638 | C2H2-type 1 | ||||
Sequence: YRCTECAKENMQKTFKNKYSFQRHAFLYH | ||||||
Zinc finger | 646-669 | C2H2-type 2 | ||||
Sequence: FPCPVCSKEFSRPDKMKNHLKMTH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P42282-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameAlpha
- Synonymsp88, A, E
- Length813
- Mass (Da)88,383
- Last updated2004-05-10 v3
- ChecksumCF3EE14069C79AA2
P17789-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameBeta
- Synonymsp69, C, D, F
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4JD39 | A0A0B4JD39_DROME | ttk | 643 | ||
A0A0B4JDG1 | A0A0B4JDG1_DROME | ttk | 813 | ||
P17789 | TTKB_DROME | ttk | 643 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 171-185 | Polar residues | ||||
Sequence: ANAGNTPTLPVQPSL | ||||||
Sequence conflict | 186 | in Ref. 2; CAA77785/CAA77786 | ||||
Sequence: L → V | ||||||
Compositional bias | 223-255 | Polar residues | ||||
Sequence: NDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHT | ||||||
Compositional bias | 256-283 | Basic and acidic residues | ||||
Sequence: DDLNESRDSLPSKRSKNSKDHRVVSHHE | ||||||
Compositional bias | 284-324 | Polar residues | ||||
Sequence: DNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSE | ||||||
Compositional bias | 356-390 | Polar residues | ||||
Sequence: TTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQ | ||||||
Sequence conflict | 358 | in Ref. 1; CAA50633 | ||||
Sequence: P → R | ||||||
Sequence conflict | 524 | in Ref. 1; CAA50633 | ||||
Sequence: E → Q |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X71626 EMBL· GenBank· DDBJ | CAA50633.1 EMBL· GenBank· DDBJ | mRNA | ||
Z11723 EMBL· GenBank· DDBJ | CAA77785.1 EMBL· GenBank· DDBJ | mRNA | ||
Z11723 EMBL· GenBank· DDBJ | CAA77786.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AE014297 EMBL· GenBank· DDBJ | AAF57179.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF57180.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN14282.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT025183 EMBL· GenBank· DDBJ | ABF00108.1 EMBL· GenBank· DDBJ | mRNA |