P42226 · STAT6_HUMAN
- ProteinSignal transducer and activator of transcription 6
- GeneSTAT6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids847 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSignal transducer and activator of transcription 6
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP42226
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Involvement in disease
Hyper-IgE syndrome 6, autosomal dominant, with recurrent infections (HIES6)
- Note
- DescriptionAn immunologic disorder characterized by severe allergic disease with onset in infancy. Common features are treatment-resistant atopic dermatitis, food allergies, asthma, eosinophilic gastrointestinal disease, and severe episodes of anaphylaxis. Half of the patients present with recurrent skin, respiratory, and viral infections. Clinical laboratory testing is notable for eosinophilia and markedly elevated serum IgE levels.
- See alsoMIM:620532
Natural variants in HIES6
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_089076 | 372 | E>K | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation after stimulation with IL4 | |
VAR_089077 | 382 | E>Q | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089078 | 419 | D>A | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089079 | 419 | D>G | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089080 | 419 | D>H | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased protein abundance in patient-derived fibroblasts | |
VAR_059812 | 419 | D>N | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4; dbSNP:rs11172102 | |
VAR_089081 | 419 | D>Y | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089082 | 519 | D>H | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089083 | 595 | K>R | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |
VAR_089084 | 643 | P>R | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_013094 | 181 | in dbSNP:rs3024952 | |||
Sequence: M → R | ||||||
Natural variant | VAR_089075 | 321 | does not affect DNA-binding transcription factor activity; does not affect STAT6 phosphorylation; dbSNP:rs767707263 | |||
Sequence: A → V | ||||||
Natural variant | VAR_089076 | 372 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation after stimulation with IL4 | |||
Sequence: E → K | ||||||
Natural variant | VAR_089077 | 382 | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: E → Q | ||||||
Natural variant | VAR_089078 | 419 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: D → A | ||||||
Natural variant | VAR_089079 | 419 | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: D → G | ||||||
Natural variant | VAR_089080 | 419 | in HIES6; likely pathogenic; gain of fuction in interleukin-4-mediated signaling pathway; increased DNA-binding transcription factor activity; increased protein abundance in patient-derived fibroblasts | |||
Sequence: D → H | ||||||
Natural variant | VAR_059812 | 419 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4; dbSNP:rs11172102 | |||
Sequence: D → N | ||||||
Natural variant | VAR_089081 | 419 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: D → Y | ||||||
Natural variant | VAR_089082 | 519 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: D → H | ||||||
Natural variant | VAR_089083 | 595 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity; increased STAT6 phosphorylation at baseline and after stimulation with IL4 | |||
Sequence: K → R | ||||||
Mutagenesis | 641 | Abolishes phosphorylation. Loss of DNA-binding transcription factor activity. | ||||
Sequence: Y → F | ||||||
Natural variant | VAR_089084 | 643 | in HIES6; likely pathogenic; increased DNA-binding transcription factor activity | |||
Sequence: P → R | ||||||
Mutagenesis | 802 | Abolishes the interaction with NCOA1; when associated with A-805. | ||||
Sequence: L → A | ||||||
Mutagenesis | 805 | Abolishes the interaction with NCOA1; when associated with A-802. | ||||
Sequence: L → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 909 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylserine | ||||
Sequence: S | |||||||
Chain | PRO_0000182433 | 2-847 | UniProt | Signal transducer and activator of transcription 6 | |||
Sequence: SLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW | |||||||
Modified residue | 641 | UniProt | Phosphotyrosine; by JAK | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 641 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 829 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Tyrosine phosphorylated following stimulation by IL3/interleukin-3 (By similarity).
Dephosphorylation on tyrosine residues by PTPN2 negatively regulates the IL4/interleukin-4 mediated signaling (PubMed:17210636).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with NCOA1 via its C-terminal LXXLL motif
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P42226 | EP300 Q09472 | 2 | EBI-1186478, EBI-447295 | |
BINARY | P42226 | IL4R P24394 | 4 | EBI-1186478, EBI-367009 | |
BINARY | P42226 | NMI Q13287 | 2 | EBI-1186478, EBI-372942 | |
BINARY | P42226 | STAT6 P42226 | 2 | EBI-1186478, EBI-1186478 | |
BINARY | P42226 | STING1 Q86WV6 | 12 | EBI-1186478, EBI-2800345 | |
BINARY | P42226 | TBK1 Q9UHD2 | 7 | EBI-1186478, EBI-356402 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 517-632 | SH2 | ||||
Sequence: WFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPE | ||||||
Motif | 802-806 | LXXLL motif | ||||
Sequence: LTKLL | ||||||
Region | 809-847 | Disordered | ||||
Sequence: GQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW | ||||||
Compositional bias | 824-847 | Polar residues | ||||
Sequence: LQPSHYGQSGISMSHMDLRANPSW |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P42226-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length847
- Mass (Da)94,135
- Last updated1995-11-01 v1
- ChecksumF35075F1C1F2A677
P42226-2
- Name2
P42226-3
- Name3
- Differences from canonical
- 1-110: Missing
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAQ5BHX1 | A0AAQ5BHX1_HUMAN | STAT6 | 433 | ||
A0AAQ5BI40 | A0AAQ5BI40_HUMAN | STAT6 | 536 | ||
H0YJH6 | H0YJH6_HUMAN | STAT6 | 865 | ||
H0YIY2 | H0YIY2_HUMAN | STAT6 | 729 | ||
Q5FBW6 | Q5FBW6_HUMAN | STAT6 | 38 | ||
G3V568 | G3V568_HUMAN | STAT6 | 144 | ||
G3V5I8 | G3V5I8_HUMAN | STAT6 | 829 | ||
G3V5K5 | G3V5K5_HUMAN | STAT6 | 159 | ||
G3V370 | G3V370_HUMAN | STAT6 | 154 | ||
G3V2L2 | G3V2L2_HUMAN | STAT6 | 64 | ||
G3V2M3 | G3V2M3_HUMAN | STAT6 | 74 | ||
A0A1W2PNW1 | A0A1W2PNW1_HUMAN | STAT6 | 797 | ||
A0A494C0T4 | A0A494C0T4_HUMAN | STAT6 | 720 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_045282 | 1-110 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_031871 | 1-174 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 149 | in Ref. 2; AAC67525 | ||||
Sequence: E → Q | ||||||
Alternative sequence | VSP_031872 | 175-177 | in isoform 2 | |||
Sequence: PSE → MEQ | ||||||
Sequence conflict | 246 | in Ref. 4; BAH14513 | ||||
Sequence: G → D | ||||||
Sequence conflict | 733 | in Ref. 2; AAC67525 | ||||
Sequence: S → N | ||||||
Compositional bias | 824-847 | Polar residues | ||||
Sequence: LQPSHYGQSGISMSHMDLRANPSW |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U16031 EMBL· GenBank· DDBJ | AAA57193.1 EMBL· GenBank· DDBJ | mRNA | ||
AF067575 EMBL· GenBank· DDBJ | AAC67525.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF067572 EMBL· GenBank· DDBJ | AAC67525.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF067573 EMBL· GenBank· DDBJ | AAC67525.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB103089 EMBL· GenBank· DDBJ | BAD89432.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290431 EMBL· GenBank· DDBJ | BAF83120.1 EMBL· GenBank· DDBJ | mRNA | ||
AK316142 EMBL· GenBank· DDBJ | BAH14513.1 EMBL· GenBank· DDBJ | mRNA | ||
AF417842 EMBL· GenBank· DDBJ | AAL06595.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC023237 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC075852 EMBL· GenBank· DDBJ | AAH75852.1 EMBL· GenBank· DDBJ | mRNA |