P41792 · EUTN_SALTY
- ProteinBacterial microcompartment shell vertex protein EutN
- GeneeutN
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probably forms vertices in the bacterial microcompartment (BMC) shell dedicated to ethanolamine degradation. Expression of eutK, eutL, eutM, eutN, eutS (eutSMNLK) in E.coli leads to formation of a single BMC (PubMed:22428024, PubMed:27063436).
Coexpression of eutQ with eutSMNLK permits E.coli to make cells with more than one mobile BMC, as is usual in vivo (PubMed:27063436).
It may be involved in transporting positively charged molecules into and out of the BMC (By similarity).
Coexpression of eutQ with eutSMNLK permits E.coli to make cells with more than one mobile BMC, as is usual in vivo (PubMed:27063436).
It may be involved in transporting positively charged molecules into and out of the BMC (By similarity).
The ethanolamine (EA) catabolic bacterial microcompartment (BMC) probably concentrates low levels of ethanolamine catabolic enzymes, concentrates volatile reaction intermediates, keeps the level of toxic acetaldehyde low, generates enough acetyl-CoA to support cell growth, and maintains a pool of free coenzyme A (CoA) and NAD.
Expression of the eut operon allows this bacteria to use ethanolamine (EA) as a carbon, nitrogen and energy source. It relies on cobalamin (vitamin B12) both as a cofactor for the ethanolamine ammonia-lyase (EAL) activity and to induce the operon (PubMed:3045078).
EA enhances bacterial survival in macrophages in a concentration-dependent manner, suggesting it is an important nutrient during infection (PubMed:29531136).
EA enhances bacterial survival in macrophages in a concentration-dependent manner, suggesting it is an important nutrient during infection (PubMed:29531136).
Miscellaneous
The need for a bacterial microcompartment in EA metabolism can be bypassed by increasing the levels of EAL and an acetaldehyde dehydrogenase (not necessarily EutE).
Biotechnology
Artificial BMCs can be made in E.coli by expressing eutK, eutL, eutM, eutN, eutS (eutSMNLK) or eutS alone. Cargo proteins can be targeted to them and beta-galactosidase (lacZ) was active within the BMC, showing the BMC allows passage of substrate into the interior. This can lead to the development of tailored BMCs for specific metabolic reactions (PubMed:22428024).
The addition of eutQ to the eutSMNLK construct results in biogenesis of multiple BMCs (PubMed:27063436).
The addition of eutQ to the eutSMNLK construct results in biogenesis of multiple BMCs (PubMed:27063436).
Pathway
Amine and polyamine degradation; ethanolamine degradation.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | bacterial microcompartment | |
Biological Process | ethanolamine catabolic process | |
Biological Process | generation of precursor metabolites and energy |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBacterial microcompartment shell vertex protein EutN
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionP41792
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
A double eutM-eutN strain grows as well as wild-type on ethanolamine (EA) and cyanocobalamin, but a quadruple eutL-eutK-eutM-eutN strain does not grow (PubMed:16291677).
A non-polar deletion mutant grows on EA at pH 5.5 to pH 7.0 but not at pH 8.0 or pH 8.5, releases increased amounts of acetaldehyde on EA plus vitamin B12. Preventing acetaldehyde vapor loss allow growth up to pH 8.5 (PubMed:16585748).
A non-polar deletion mutant grows on EA at pH 5.5 to pH 7.0 but not at pH 8.0 or pH 8.5, releases increased amounts of acetaldehyde on EA plus vitamin B12. Preventing acetaldehyde vapor loss allow growth up to pH 8.5 (PubMed:16585748).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000087093 | 1-99 | Bacterial microcompartment shell vertex protein EutN | |||
Sequence: MEADMKLAVVTGQIVCTVRHQGLAHDKLLMVEMIDAQGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDEVVAGGKVVFHK |
Proteomic databases
Expression
Induction
Part of the 17-gene eut operon transcribed from a single promoter, induced by ethanolamine and adenosylcobalamin (AdoCbl, vitamin B12).
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-87 | BMV | ||||
Sequence: MKLAVVTGQIVCTVRHQGLAHDKLLMVEMIDAQGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVD |
Sequence similarities
Belongs to the CcmL/EutN family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length99
- Mass (Da)10,351
- Last updated1995-11-01 v1
- Checksum4C543D983D2A6DC7
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U18560 EMBL· GenBank· DDBJ | AAA80208.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF093749 EMBL· GenBank· DDBJ | AAC78117.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE006468 EMBL· GenBank· DDBJ | AAL21358.1 EMBL· GenBank· DDBJ | Genomic DNA |