P41732 · TSN7_HUMAN
- ProteinTetraspanin-7
- GeneTSPAN7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids249 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be involved in cell proliferation and cell motility.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTetraspanin-7
- Short namesTspan-7
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP41732
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-16 | Cytoplasmic | ||||
Sequence: MASRRMETKPVITCLK | ||||||
Transmembrane | 17-40 | Helical | ||||
Sequence: TLLIIYSFVFWITGVILLAVGVWG | ||||||
Topological domain | 41-56 | Extracellular | ||||
Sequence: KLTLGTYISLIAENST | ||||||
Transmembrane | 57-75 | Helical | ||||
Sequence: NAPYVLIGTGTTIVVFGLF | ||||||
Topological domain | 76-86 | Cytoplasmic | ||||
Sequence: GCFATCRGSPW | ||||||
Transmembrane | 87-112 | Helical | ||||
Sequence: MLKLYAMFLSLVFLAELVAGISGFVF | ||||||
Topological domain | 113-213 | Extracellular | ||||
Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM | ||||||
Transmembrane | 214-234 | Helical | ||||
Sequence: GIIAGVAFGIAFSQLIGMLLA | ||||||
Topological domain | 235-249 | Cytoplasmic | ||||
Sequence: CCLSRFITANQYEMV |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Intellectual developmental disorder, X-linked 58 (XLID58)
- Note
- DescriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked intellectual disability, while syndromic intellectual disability presents with associated physical, neurological and/or psychiatric manifestations.
- See alsoMIM:300210
Natural variants in XLID58
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_009259 | 172 | P>H | in XLID58; dbSNP:rs104894951 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_037905 | 53 | in dbSNP:rs17851592 | |||
Sequence: E → K | ||||||
Natural variant | VAR_037906 | 127 | in dbSNP:rs17851593 | |||
Sequence: A → T | ||||||
Natural variant | VAR_009259 | 172 | in XLID58; dbSNP:rs104894951 | |||
Sequence: P → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 165 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219248 | 1-249 | Tetraspanin-7 | |||
Sequence: MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV | ||||||
Glycosylation | 54 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 155 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 158 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 177 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 188 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.
Gene expression databases
Organism-specific databases
Interaction
Subunit
(Microbial infection) Interacts with herpes simplex virus 1 (HHV-1) UL35.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P41732 | FAM209A Q5JX71 | 3 | EBI-1042779, EBI-18304435 | |
BINARY | P41732 | GPR152 Q8TDT2 | 3 | EBI-1042779, EBI-13345167 | |
BINARY | P41732 | LHFPL5 Q8TAF8 | 3 | EBI-1042779, EBI-2820517 | |
BINARY | P41732 | MEOX2 Q6FHY5 | 3 | EBI-1042779, EBI-16439278 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length249
- Mass (Da)27,574
- Last updated2001-11-16 v2
- ChecksumF2CF4517DB388173
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 136 | in Ref. 5; CAB65594 | ||||
Sequence: E → K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D10653 EMBL· GenBank· DDBJ | BAA01501.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK312343 EMBL· GenBank· DDBJ | BAG35264.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471141 EMBL· GenBank· DDBJ | EAW59437.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D29808 EMBL· GenBank· DDBJ | BAA06191.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AJ250562 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250563 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250564 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250565 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250566 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250567 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ250568 EMBL· GenBank· DDBJ | CAB65594.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB062057 EMBL· GenBank· DDBJ | BAB55825.1 EMBL· GenBank· DDBJ | mRNA | ||
AB062057 EMBL· GenBank· DDBJ | BAB55824.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471141 EMBL· GenBank· DDBJ | EAW59438.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC018036 EMBL· GenBank· DDBJ | AAH18036.1 EMBL· GenBank· DDBJ | mRNA |