P41546 · HAC1_YEAST
- ProteinTranscriptional activator HAC1
- GeneHAC1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids238 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional activator involved in the unfolded protein response (UPR) pathway. Recognizes and binds to the UPR element (UPRE) in the promoter of UPR-regulated genes such as KAR2, PDI1, EUG1 and FKB2. Increases the synthesis of endoplasmic reticulum-resident proteins required for protein folding as well as components of the secretory pathway.
Miscellaneous
Present with 8970 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Biological Process | endoplasmic reticulum unfolded protein response | |
Biological Process | meiotic cell cycle | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | response to endoplasmic reticulum stress |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscriptional activator HAC1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP41546
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000076518 | 1-238 | Transcriptional activator HAC1 | |||
Sequence: MEMTDFELTSNSQSNLAIPTNFKSTLPPRKRAKTKEEKEQRRIERILRNRRAAHQSREKKRLHLQYLERKCSLLENLLNSVNLEKLADHEDALTCSHDAFVASLDEYRDFQSTRGASLDTRASSHSSSDTFTPSPLNCTMEPATLSPKSMRDSASDQETSWELQMFKTENVPESTTLPAVDNNNLFDAVASPLADPLCDDIAGNSLPFDNSIDLDNWRNPEAQSGLNSFELNDFFITS |
Proteomic databases
PTM databases
Expression
Induction
By the unfolded protein response pathway. Accumulation of unfolded proteins in the ER leads to activation of IRE1, which initiates splicing of the untranslated HAC1 precursor mRNA to produce the mature form.
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-22 | Polar residues | ||||
Sequence: MEMTDFELTSNSQSNLAIPTNF | ||||||
Region | 1-39 | Disordered | ||||
Sequence: MEMTDFELTSNSQSNLAIPTNFKSTLPPRKRAKTKEEKE | ||||||
Domain | 39-102 | bZIP | ||||
Sequence: EQRRIERILRNRRAAHQSREKKRLHLQYLERKCSLLENLLNSVNLEKLADHEDALTCSHDAFVA | ||||||
Region | 41-61 | Basic motif | ||||
Sequence: RRIERILRNRRAAHQSREKKR | ||||||
Region | 67-74 | Leucine-zipper | ||||
Sequence: LERKCSLL | ||||||
Region | 115-152 | Disordered | ||||
Sequence: GASLDTRASSHSSSDTFTPSPLNCTMEPATLSPKSMRD |
Sequence similarities
Belongs to the bZIP family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing. Splicing occurs by a non-spliceosomal, regulated splicing mechanism. When UPR is induced, the mRNA is cleaved by bifunctional transmembrane kinase/endoribonuclease IRE1 and the exons are joined by tRNA ligase TRL1.
P41546-2
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameI
- SynonymsInduced
- NoteInduced and active isoform.
- Length238
- Mass (Da)26,905
- Last updated2006-10-03 v2
- Checksum81C01ACB3E2531B1
P41546-1
- NameU
- SynonymsUninduced
- NoteNot translated. The unspliced HAC1 mRNA is stable, located in the cytoplasm, and is associated with polyribosomes, yet does not produce protein. Translational attenuation is due to basepairing of the intron with the 5'-UTR of the mRNA.
- Differences from canonical
- 221-238: EAQSGLNSFELNDFFITS → AVITMTRKLQ
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-22 | Polar residues | ||||
Sequence: MEMTDFELTSNSQSNLAIPTNF | ||||||
Sequence conflict | 181 | in Ref. 1; BAA05513 | ||||
Sequence: D → Y | ||||||
Alternative sequence | VSP_020905 | 221-238 | in isoform U | |||
Sequence: EAQSGLNSFELNDFFITS → AVITMTRKLQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D26506 EMBL· GenBank· DDBJ | BAA05513.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
D50617 EMBL· GenBank· DDBJ | BAA24425.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D86413 EMBL· GenBank· DDBJ | BAA19565.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006940 EMBL· GenBank· DDBJ | DAA12409.1 EMBL· GenBank· DDBJ | Genomic DNA |