P41223 · BUD31_HUMAN
- ProteinProtein BUD31 homolog
- GeneBUD31
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids144 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the pre-mRNA splicing process (PubMed:28076346, PubMed:28502770).
May play a role as regulator of AR transcriptional activity; may increase AR transcriptional activity (PubMed:25091737).
May play a role as regulator of AR transcriptional activity; may increase AR transcriptional activity (PubMed:25091737).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | spliceosomal complex | |
Cellular Component | U2-type catalytic step 2 spliceosome | |
Molecular Function | nuclear receptor binding | |
Molecular Function | nuclear receptor coactivator activity | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | positive regulation of androgen receptor activity |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein BUD31 homolog
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP41223
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Detected in chromatin at the promoter of AR target genes.
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 155 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000193897 | 1-144 | Protein BUD31 homolog | |||
Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG | ||||||
Modified residue | 125 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in epithelial and stromal cells in benign prostate hyperplasia tissue (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Identified in the spliceosome C complex (PubMed:28076346, PubMed:28502770).
May interact with AR (PubMed:25091737).
May interact with AR (PubMed:25091737).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P41223 | BEND5 Q7L4P6 | 3 | EBI-3904603, EBI-724373 | |
BINARY | P41223 | HOXA1 P49639 | 3 | EBI-3904603, EBI-740785 | |
BINARY | P41223 | KRTAP10-7 P60409 | 6 | EBI-3904603, EBI-10172290 | |
BINARY | P41223 | MEOX2 Q6FHY5 | 3 | EBI-3904603, EBI-16439278 | |
BINARY | P41223 | PICK1 Q9NRD5 | 3 | EBI-3904603, EBI-79165 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 2-10 | Nuclear localization signal | ||||
Sequence: PKVKRSRKA | ||||||
Region | 59-67 | Interaction with AR | ||||
Sequence: YIFDLFYKR |
Domain
Contains a short sequence motif (Phe-Xaa-Xaa-Phe-Tyr) that can bind to AR and may modulate AR activity.
Sequence similarities
Belongs to the BUD31 (G10) family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P41223-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length144
- Mass (Da)17,000
- Last updated2002-10-10 v2
- Checksum520B8E74C97D0926
P41223-2
- Name2
- Differences from canonical
- 129-144: GRIIECTHCGCRGCSG → VMSDTQAWCCFQLKILP
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 12 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: P → Q | ||||||
Sequence conflict | 24 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: E → Q | ||||||
Sequence conflict | 70 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: I → Y | ||||||
Sequence conflict | 75-79 | in Ref. 1; AAA20008 | ||||
Sequence: YEYCI → LDICY | ||||||
Sequence conflict | 83 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: Y → L | ||||||
Sequence conflict | 89 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: I → L | ||||||
Sequence conflict | 97-98 | in Ref. 1; AAA20008/AAB33291 | ||||
Sequence: YE → IG | ||||||
Alternative sequence | VSP_055558 | 129-144 | in isoform 2 | |||
Sequence: GRIIECTHCGCRGCSG → VMSDTQAWCCFQLKILP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U11861 EMBL· GenBank· DDBJ | AAA20008.1 EMBL· GenBank· DDBJ | mRNA | ||
S77329 EMBL· GenBank· DDBJ | AAB33291.1 EMBL· GenBank· DDBJ | mRNA | ||
AK297784 EMBL· GenBank· DDBJ | BAH12665.1 EMBL· GenBank· DDBJ | mRNA | ||
AK316477 EMBL· GenBank· DDBJ | BAH14848.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456951 EMBL· GenBank· DDBJ | CAG33232.1 EMBL· GenBank· DDBJ | mRNA | ||
AC004922 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH236956 EMBL· GenBank· DDBJ | EAL23881.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471091 EMBL· GenBank· DDBJ | EAW76670.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471091 EMBL· GenBank· DDBJ | EAW76671.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471091 EMBL· GenBank· DDBJ | EAW76672.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471091 EMBL· GenBank· DDBJ | EAW76673.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC022821 EMBL· GenBank· DDBJ | AAH22821.1 EMBL· GenBank· DDBJ | mRNA | ||
BC104670 EMBL· GenBank· DDBJ | AAI04671.1 EMBL· GenBank· DDBJ | mRNA |