P40847 · SAP1_SCHPO
- ProteinSwitch-activating protein 1
- Genesap1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids254 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to sequences required for mating-type switching. Makes a simultaneous contact with both the alpha and beta domains of the switch-activating site SAS1. Also binds to replication fork barrier 1 (RFB1) located within a 78 base pair sequence near the 3' end of the rRNA coding region. This leads to replication fork blockage. It binds the consensus sequence 5'-TA[AG]GCAGNTN[CT]AACG[AC]G-3'.
Has a role in chromosome organization and integrity where it is involved in chromosome segregation. Has a role in sister chromatid cohesion and condensation.
Miscellaneous
Present with 20000 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA binding, bending | |
Molecular Function | rDNA spacer replication fork barrier binding | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | chromosome segregation | |
Biological Process | gene conversion at mating-type locus | |
Biological Process | mitotic pre-replicative complex assembly | |
Biological Process | replication fork arrest at rDNA repeats | |
Biological Process | site-specific DNA replication termination |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSwitch-activating protein 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionP40847
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097581 | 1-254 | Switch-activating protein 1 | |||
Sequence: MEAPKMELKSYKRKNASLSPSSSPAKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLSELQQYREKFLVGKRKCDCNDEINERLKKLTEEQQNVDMLVAKVNFLSKHLHDNEEKLMQVNAKMDEVLAENKRLQQLLDHNDLLSKLEPPSAYAPHGVNMGTNMGANMGANMNAIRGGLHSSISPNLGDH | ||||||
Modified residue | 17 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 19 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MEAPKMELKSYKRKNASLSPSSSPAKAQRT | ||||||
Compositional bias | 14-29 | Polar residues | ||||
Sequence: KNASLSPSSSPAKAQR | ||||||
Repeat | 221-224 | 1 | ||||
Sequence: GVNM | ||||||
Region | 221-236 | 4 X 4 AA tandem repeats of G-[ATV]-N-M | ||||
Sequence: GVNMGTNMGANMGANM | ||||||
Repeat | 225-228 | 2 | ||||
Sequence: GTNM | ||||||
Repeat | 229-232 | 3 | ||||
Sequence: GANM | ||||||
Repeat | 233-236 | 4 | ||||
Sequence: GANM |
Domain
The N-terminus may contain the DNA-binding domain. Last 40 residues of the C-terminus are required for chromosome segregation.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length254
- Mass (Da)29,127
- Last updated1998-07-15 v2
- Checksum570DCE20C3C20847
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 14-29 | Polar residues | ||||
Sequence: KNASLSPSSSPAKAQR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X77578 EMBL· GenBank· DDBJ | CAA54684.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CU329672 EMBL· GenBank· DDBJ | CAA20440.1 EMBL· GenBank· DDBJ | Genomic DNA |