P40562 · MPH1_YEAST
- ProteinATP-dependent DNA helicase MPH1
- GeneMPH1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids993 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
ATP-dependent DNA helicase involved in DNA damage repair by homologous recombination and in genome maintenance (PubMed:10880470, PubMed:15126389, PubMed:15634678, PubMed:16121259).
Capable of unwinding D-loops (PubMed:19136626).
Plays a role in limiting crossover recombinants during mitotic DNA double-strand break (DSB) repair (PubMed:19136626).
Prevents crossovers between ectopic sequences by removing substrates for MUS81-MMS4 or RAD1-RAD10 cleavage (PubMed:24119400).
Component of a FANCM-MHF complex which promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (Probable) (PubMed:22912599).
Binds to flap-structured DNA but not to non-flap nicked DNA, and participates in Okazaki fragment processing by stimulating the endonuclease activities of FEN1 and DNA2 (PubMed:19181670).
Involved in recombination donor preference during mating-type switching via interaction with FKH1 (PubMed:27257873).
Capable of unwinding D-loops (PubMed:19136626).
Plays a role in limiting crossover recombinants during mitotic DNA double-strand break (DSB) repair (PubMed:19136626).
Prevents crossovers between ectopic sequences by removing substrates for MUS81-MMS4 or RAD1-RAD10 cleavage (PubMed:24119400).
Component of a FANCM-MHF complex which promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (Probable) (PubMed:22912599).
Binds to flap-structured DNA but not to non-flap nicked DNA, and participates in Okazaki fragment processing by stimulating the endonuclease activities of FEN1 and DNA2 (PubMed:19181670).
Involved in recombination donor preference during mating-type switching via interaction with FKH1 (PubMed:27257873).
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | 3'-5' DNA helicase activity | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | DNA/RNA helicase activity | |
Molecular Function | flap-structured DNA binding | |
Molecular Function | four-way junction DNA binding | |
Molecular Function | four-way junction helicase activity | |
Biological Process | DNA replication, Okazaki fragment processing | |
Biological Process | donor selection | |
Biological Process | double-strand break repair via synthesis-dependent strand annealing | |
Biological Process | interstrand cross-link repair | |
Biological Process | negative regulation of strand invasion | |
Biological Process | recombinational repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent DNA helicase MPH1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP40562
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Causes transiant accumulation of ectopic joint molecules (JMs) (PubMed:24119400).
Leads to a defect in donor preference during mating-type switching (PubMed:27257873).
Does not affect FKH1's overlapping role with FKH2 of regulation of the expression of the CLB2 cluster of genes during the G2/M phase of the mitotic cell cycle (PubMed:27257873).
Leads to a defect in donor preference during mating-type switching (PubMed:27257873).
Does not affect FKH1's overlapping role with FKH2 of regulation of the expression of the CLB2 cluster of genes during the G2/M phase of the mitotic cell cycle (PubMed:27257873).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 774 | Reduces the interaction with FKH1; when associated with A-785. | ||||
Sequence: D → A | ||||||
Mutagenesis | 775 | Reduces the interaction with FKH1; when associated with A-785. | ||||
Sequence: S → A | ||||||
Mutagenesis | 776 | Abolishes the interaction with FKH1; when associated with A-785. | ||||
Sequence: T → A | ||||||
Mutagenesis | 777 | Reduces the interaction with FKH1; when associated with A-785. | ||||
Sequence: E → A | ||||||
Mutagenesis | 782 | Reduces the interaction with FKH1; when associated with A-776. | ||||
Sequence: S → A | ||||||
Mutagenesis | 784 | Reduces the interaction with FKH1; when associated with A-776. | ||||
Sequence: E → A | ||||||
Mutagenesis | 785 | Abolishes the interaction with FKH1; when associated with A-776. | ||||
Sequence: T → A | ||||||
Mutagenesis | 786 | Reduces the interaction with FKH1; when associated with A-776. | ||||
Sequence: E → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000055193 | 1-993 | ATP-dependent DNA helicase MPH1 | |||
Sequence: MASADDYFSDFEDDELDKLYEKAINKSVKETITRRAVPVQKDLHDNVLPGQKTVYEEIQRDVSFGPTHHELDYDALSFYVYPTNYEVRDYQYTIVHKSLFQNTLCAIPTGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPSDQTAILLDKSRKNREEIWANKRVFFATPQVVENDLKRGVLDPKDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGVQEVVNNLDISKIEIRTEESMDIVKYMKKRKKEKIEVPLLLEIEDIIEQLGMAVKPVLQQAIELGIYEECDPSQINAFKAMQQSQKIIANPTIPEGIKWRNFFILQLLNNVGQMLKRLKIYGIRTFFNYFQNKCTEFTTKYNLKKSTNKIAAEFYYHPILKNIKNQCENYLSDPKFVGHGKLQCVRDELMDFFQKRGSDSRVIIFTELRESALEIVKFIDSVADDQIRPHIFIGQARAKEGFDEVKYTRKHAPKGRKKVERLHRQEQEKFLEAERTKRAANDKLERSARRTGSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIVLLFSSNESYKFERAMEDYSTLQALISKQCIDYKKSDRIIPEDIIPECHETLITINDENEIINEMEDVDEVIRYATQCMMGKKVKPKKAITKKKRVQENKKPKKFFMPDNVETSIVSASTLINKFLVNESGGKQLVTSNENPSKKRKIFKALDNLENDSTEEASSSLETEDEEVSDDNNVFIAEGQNGCQKDLETAIIRTGESLTTLKPLHNFERPNMALFVNDCGLPTKIEKNVKDIRGNQHNLEKEKSCTVDKNNMVLSLDDWNFFRNRYIPEGVSFDVEPNFVQYTKGVKVPHCHKVSKIITLFNDESNDNKKRTIDMNYTKCLARGMLRDEKKFVKVNDKSQVDNNSVNHDSSQSFTLSNAELDDILGSDSDF | ||||||
Modified residue | 776 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 785 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylation at both Thr-776 and Thr-785 is required for the interaction with FKH1.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with the MHF histone-fold complex composed of MHF1 and MHF2 to form the FANCM-MHF complex (By similarity).
Interacts with FHK1 (PubMed:27257873).
Interacts with FHK1 (PubMed:27257873).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P40562 | SMC5 Q08204 | 5 | EBI-25369, EBI-34125 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 94-261 | Helicase ATP-binding | ||||
Sequence: IVHKSLFQNTLCAIPTGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPSDQTAILLDKSRKNREEIWANKRVFFATPQVVENDLKRGVLDPKDIVCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGVQEVVNNLDISK | ||||||
Motif | 209-212 | DEAH box | ||||
Sequence: DEAH | ||||||
Domain | 507-655 | Helicase C-terminal | ||||
Sequence: KVERLHRQEQEKFLEAERTKRAANDKLERSARRTGSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIVLLFSSNESYKFERAMEDYSTLQALISKQCIDYKKSDRI | ||||||
Region | 530-551 | Disordered | ||||
Sequence: NDKLERSARRTGSSEEAQISGM | ||||||
Region | 751-810 | FKH1-binding region | ||||
Sequence: LVTSNENPSKKRKIFKALDNLENDSTEEASSSLETEDEEVSDDNNVFIAEGQNGCQKDLE |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length993
- Mass (Da)114,058
- Last updated1995-02-01 v1
- Checksum474DDC99C543171F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X79743 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z38062 EMBL· GenBank· DDBJ | CAA86204.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006942 EMBL· GenBank· DDBJ | DAA08548.1 EMBL· GenBank· DDBJ | Genomic DNA |