P40512 · CSN11_YEAST
- ProteinCop9 signalosome complex subunit 11
- GenePCI8
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids444 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes The CSN complex is involved in the regulation of the mating pheromone response. PCI8 may also be involved in transcriptional and translational control.
Miscellaneous
Present with 504 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COP9 signalosome | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Biological Process | adaptation of signaling pathway by response to pheromone involved in conjugation with cellular fusion | |
Biological Process | protein deneddylation | |
Biological Process | regulation of protein neddylation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCop9 signalosome complex subunit 11
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP40512
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000121028 | 1-444 | Cop9 signalosome complex subunit 11 | |||
Sequence: MFHGAKGPLLIERIGHLLSINYGEKEERKRWAMQGISYLQEVQCTSTPYLEILVEESGLRPVSLLNSQLVGKPHFSLLGGFDENIARDIISHNFQNAIFQMESEEVPLTKRYQHLEKITQISLLCKNFKGIEEIEYNVKNIIQGRKNFDMLNSMEKDRISHEVVQDDSFSLLRIQMLLCVSYFLQERYFDCCTKFFTMMTSEPLTLKVLSEHLDCMNFISKEEFIMMVNISVLISIPLDNYDDFIYLSDLKQFFQMTPLLVNCLELLINTNFNKFFKIWHGEINKICMESLFLEPSWSSSAAVIMRCKIYFFYLRISKKLQFSYLSSTLGIDLEDIKEELTKLIISGQLNFEIDGDVIHFEDSSILQSIVNEISRNGTMINEVIDKLKNENTDLKDIIQGNPLMYSGGNNTATIINNESSDDMDIDEVNDRSDISDSEGGLFEC |
Proteomic databases
PTM databases
Interaction
Subunit
Component of a COP9 signalosome-like (CSN) complex, composed of RRI1/CSN5, CSN9, RRI2/CSN10, PCI8/CSN11, CSN12 and CSI1. Interacts with PRT1 and RPG1, 2 subunits of the core complex of translation initiation factor 3 (eIF3).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 195-367 | PCI | ||||
Sequence: FFTMMTSEPLTLKVLSEHLDCMNFISKEEFIMMVNISVLISIPLDNYDDFIYLSDLKQFFQMTPLLVNCLELLINTNFNKFFKIWHGEINKICMESLFLEPSWSSSAAVIMRCKIYFFYLRISKKLQFSYLSSTLGIDLEDIKEELTKLIISGQLNFEIDGDVIHFEDSSILQ | ||||||
Region | 419-439 | Disordered | ||||
Sequence: SSDDMDIDEVNDRSDISDSEG |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length444
- Mass (Da)51,288
- Last updated1995-02-01 v1
- Checksum60C3FCD0237CFEB0
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z38060 EMBL· GenBank· DDBJ | CAA86152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006942 EMBL· GenBank· DDBJ | DAA08479.1 EMBL· GenBank· DDBJ | Genomic DNA |