P40457 · MLP2_YEAST
- ProteinProtein MLP2
- GeneMLP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1679 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Together with the closely related MLP1, involved in the structural and functional organization of perinuclear chromatin (PubMed:10638763).
MLP1/MLP2 associate with the nuclear pore complex and form filamentous structures along the nuclear periphery (PubMed:10085285, PubMed:10617624, PubMed:24152732).
Has a role in the localization of Esc1 to nucleolar regions (PubMed:24152732).
Together with MLP1, mediates tethering of the some telomeres to the nuclear periphery, probably mediated by YKU70/YKU80 (HDF1/HDF2) heterodimer and show perinuclear location dependent silencing (PubMed:11862215).
MLP1 and MLP2 are involved in telomere length regulation but not silencing or telomere anchoring (PubMed:12490156).
Plays a role in the incorporation of components into the spindle pole body (PubMed:10617624, PubMed:14718167, PubMed:16027220).
Involved in double-strand break repair, probably also mediated by the YKU70/YKU80 (HDF1/HDF2) heterodimer (PubMed:10638763, PubMed:14718167, PubMed:16027220).
MLP1/MLP2 associate with the nuclear pore complex and form filamentous structures along the nuclear periphery (PubMed:10085285, PubMed:10617624, PubMed:24152732).
Has a role in the localization of Esc1 to nucleolar regions (PubMed:24152732).
Together with MLP1, mediates tethering of the some telomeres to the nuclear periphery, probably mediated by YKU70/YKU80 (HDF1/HDF2) heterodimer and show perinuclear location dependent silencing (PubMed:11862215).
MLP1 and MLP2 are involved in telomere length regulation but not silencing or telomere anchoring (PubMed:12490156).
Plays a role in the incorporation of components into the spindle pole body (PubMed:10617624, PubMed:14718167, PubMed:16027220).
Involved in double-strand break repair, probably also mediated by the YKU70/YKU80 (HDF1/HDF2) heterodimer (PubMed:10638763, PubMed:14718167, PubMed:16027220).
Miscellaneous
Present with 2770 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | nuclear envelope | |
Cellular Component | nuclear pore | |
Cellular Component | nuclear pore nuclear basket | |
Cellular Component | nucleoplasm | |
Cellular Component | spindle pole body | |
Molecular Function | ribonucleoprotein complex binding | |
Molecular Function | structural constituent of nuclear pore | |
Biological Process | mRNA export from nucleus | |
Biological Process | negative regulation of protein import into nucleus during spindle assembly checkpoint | |
Biological Process | nucleocytoplasmic transport | |
Biological Process | poly(A)+ mRNA export from nucleus | |
Biological Process | post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery | |
Biological Process | protein import into nucleus | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | spindle pole body organization | |
Biological Process | telomere tethering at nuclear periphery | |
Biological Process | transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein MLP2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP40457
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Nuclear periphery, excluded from nuclear envelope adjacent to nucleolus.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000096502 | 1-1679 | Protein MLP2 | |||
Sequence: MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE | ||||||
Modified residue | 1512 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1670 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the nuclear complex (NPC) (PubMed:24152732).
NPC constitutes the exclusive means of nucleocytoplasmic transport (PubMed:24152732).
NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope (PubMed:24152732).
Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof (PubMed:24152732).
Interacts with NUP60 and NIC96, which tether it to the nuclear pore complex. Component of the spindle pole body core in which it interacts directly with SPC110, SPC42 and SPC29. Also interacts with YKU70 (HDF1) and MLP1
NPC constitutes the exclusive means of nucleocytoplasmic transport (PubMed:24152732).
NPCs allow the passive diffusion of ions and small molecules and the active, nuclear transport receptor-mediated bidirectional transport of macromolecules such as proteins, RNAs, ribonucleoparticles (RNPs), and ribosomal subunits across the nuclear envelope (PubMed:24152732).
Due to its 8-fold rotational symmetry, all subunits are present with 8 copies or multiples thereof (PubMed:24152732).
Interacts with NUP60 and NIC96, which tether it to the nuclear pore complex. Component of the spindle pole body core in which it interacts directly with SPC110, SPC42 and SPC29. Also interacts with YKU70 (HDF1) and MLP1
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P40457 | MLP1 Q02455 | 3 | EBI-25261, EBI-11009 | |
BINARY | P40457 | SPC110 P32380 | 3 | EBI-25261, EBI-12369 | |
BINARY | P40457 | SPC29 P33419 | 2 | EBI-25261, EBI-12041 | |
BINARY | P40457 | SPC42 P36094 | 3 | EBI-25261, EBI-17777 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 32-176 | |||||
Sequence: AKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDT | ||||||
Coiled coil | 233-466 | |||||
Sequence: YNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVK | ||||||
Motif | 417-433 | Bipartite nuclear localization signal 1 | ||||
Sequence: KRSTELLETVSLTKRKQ | ||||||
Coiled coil | 516-1064 | |||||
Sequence: FSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYEREL | ||||||
Motif | 639-655 | Bipartite nuclear localization signal 2 | ||||
Sequence: RKELLIYKKSQCKKKTT | ||||||
Coiled coil | 1099-1491 | |||||
Sequence: KLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAG | ||||||
Motif | 1433-1449 | Bipartite nuclear localization signal 3 | ||||
Sequence: KKEWLKEYEDETLRRIK | ||||||
Region | 1495-1521 | Disordered | ||||
Sequence: FLDNKGSGEDAEEELWNSPSKGNSERP | ||||||
Compositional bias | 1632-1657 | Polar residues | ||||
Sequence: DLTNNSTDGAKITEIGSTSKRPIESG | ||||||
Region | 1632-1679 | Disordered | ||||
Sequence: DLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE | ||||||
Compositional bias | 1658-1672 | Basic and acidic residues | ||||
Sequence: TSSDPDTKKVKESPA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,679
- Mass (Da)195,141
- Last updated1995-02-01 v1
- Checksum298950CC52202D8F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1632-1657 | Polar residues | ||||
Sequence: DLTNNSTDGAKITEIGSTSKRPIESG | ||||||
Compositional bias | 1658-1672 | Basic and acidic residues | ||||
Sequence: TSSDPDTKKVKESPA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z38059 EMBL· GenBank· DDBJ | CAA86129.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006942 EMBL· GenBank· DDBJ | DAA08404.1 EMBL· GenBank· DDBJ | Genomic DNA |