P40339 · RFC4_YEAST
- ProteinReplication factor C subunit 4
- GeneRFC4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids323 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of ATP-dependent clamp loader (RFC and RFC-like) complexes for DNA clamps, such as the POL30/PCNA homotrimer and the checkpoint clamp DDC1:MEC3:RAD17 complex. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighboring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA. Component of the replication factor C (RFC or activator 1) complex which loads POL30/PCNA and acts during elongation of primed DNA templates by DNA polymerase delta and epsilon. RFC has an essential but redundant activity in sister chromatid cohesion establishment. Component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. Component of the RFC-like RAD24-RFC complex which loads the checkpoint clamp DDC1:MEC3:RAD17 complex and is involved in DNA repair pathways. Component of the RFC-like ELG1-RFC complex which appears to have a role in DNA replication, replication fork re-start, recombination and repair.
Miscellaneous
Present with 2760 molecules/cell in log phase SD medium.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | Ctf18 RFC-like complex | |
Cellular Component | cytosol | |
Cellular Component | DNA replication factor C complex | |
Cellular Component | Elg1 RFC-like complex | |
Cellular Component | nucleus | |
Cellular Component | Rad17 RFC-like complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | DNA binding | |
Biological Process | DNA clamp unloading | |
Biological Process | DNA damage checkpoint signaling | |
Biological Process | DNA repair | |
Biological Process | DNA-templated DNA replication | |
Biological Process | leading strand elongation | |
Biological Process | mitotic sister chromatid cohesion | |
Biological Process | sister chromatid cohesion |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameReplication factor C subunit 4
- Short namesReplication factor C4
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP40339
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000121771 | 1-323 | Replication factor C subunit 4 | |||
Sequence: MSKTLSLQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNKA |
Proteomic databases
PTM databases
Interaction
Subunit
Replication factor C (RFC) is a heteropentamer of subunits RFC1, RFC2, RFC3, RFC4 and RFC5 and forms a complex with POL30/PCNA in the presence of ATP. Component of the RAD24-RFC complex which consists of RAD14, RFC2, RFC3, RFC4 and RFC5 and associates with the checkpoint clamp DDC1:MEC3:RAD17 complex. Component of the ELG1-RFC complex which consists of ELG1, RFC2, RFC3, RFC4 and RFC5. Component of the CTF18-RFC complex, which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. RFC4 interacts with ECO1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P40339 | CTF18 P49956 | 6 | EBI-15009, EBI-4560 | |
BINARY | P40339 | CTF8 P38877 | 3 | EBI-15009, EBI-5216 | |
BINARY | P40339 | ELG1 Q12050 | 6 | EBI-15009, EBI-32195 | |
BINARY | P40339 | RAD24 P32641 | 3 | EBI-15009, EBI-14675 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length323
- Mass (Da)36,149
- Last updated1995-02-01 v1
- Checksum1F55F35F0713331F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L20502 EMBL· GenBank· DDBJ | AAA34970.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U26030 EMBL· GenBank· DDBJ | AAC49063.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X83121 EMBL· GenBank· DDBJ | CAA58185.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74836 EMBL· GenBank· DDBJ | CAA99106.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA10690.1 EMBL· GenBank· DDBJ | Genomic DNA |