P40096 · NCB1_YEAST
- ProteinNegative cofactor 2 complex subunit alpha
- GeneBUR6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids142 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the NC2 complex which represses RNA polymerase II transcription through binding to SPT15/TBP and thereby inhibiting the assembly of the preinitiation complex. The NC2 complex may also mediate transcriptional activation from TATA-driven promoters through association with SPT15/TBP.
Miscellaneous
Present with 5130 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | negative cofactor 2 complex | |
Cellular Component | nucleus | |
Molecular Function | chromatin binding | |
Molecular Function | core promoter sequence-specific DNA binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | RNA polymerase II general transcription initiation factor activity | |
Molecular Function | transcription coactivator activity | |
Molecular Function | transcription corepressor activity | |
Biological Process | cellular response to heat | |
Biological Process | negative regulation of RNA polymerase II transcription preinitiation complex assembly | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | RNA polymerase II preinitiation complex assembly | |
Biological Process | transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNegative cofactor 2 complex subunit alpha
- Short namesNC2 complex subunit alpha
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP40096
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000096755 | 1-142 | Negative cofactor 2 complex subunit alpha | |||
Sequence: MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELGDVFDRIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEKFDFLREGLCVEEGQTQPEEESA | ||||||
Modified residue | 27 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 141 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the NC2 (negative cofactor 2) complex composed of BUR6 and NCB2. The NC2 complex associates with SPT15/TBP. Interacts with SPT15/TBP.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P40096 | NCB2 Q92317 | 6 | EBI-11908, EBI-37723 | |
BINARY | P40096 | SPT15 P13393 | 2 | EBI-11908, EBI-19129 |
Complex viewer
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-43 | Disordered | ||||
Sequence: MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELG | ||||||
Compositional bias | 29-43 | Polar residues | ||||
Sequence: VGNMGTNSNNNNELG | ||||||
Domain | 29-137 | Histone-fold | ||||
Sequence: VGNMGTNSNNNNELGDVFDRIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEKFDFLREGLCVEEGQTQP |
Sequence similarities
Belongs to the NC2 alpha/DRAP1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length142
- Mass (Da)15,517
- Last updated1995-02-01 v1
- Checksum27341BD250973BA7
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 29-43 | Polar residues | ||||
Sequence: VGNMGTNSNNNNELG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y09265 EMBL· GenBank· DDBJ | CAA70460.1 EMBL· GenBank· DDBJ | mRNA | ||
U18917 EMBL· GenBank· DDBJ | AAB64686.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY693203 EMBL· GenBank· DDBJ | AAT93222.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006939 EMBL· GenBank· DDBJ | DAA07820.1 EMBL· GenBank· DDBJ | Genomic DNA |