P39745 · MPK1_CAEEL
- ProteinMitogen-activated protein kinase mpk-1
- Genempk-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids444 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions in let-60 Ras signaling pathway; acts downstream of lin-45 raf kinase, but before the lin-1 gene product in controlling vulval cell differentiation (PubMed:8299935, PubMed:8299936).
Plays a negative role in proximal germline proliferation in the mitotic zone (PubMed:16319922).
Required for progression of developing oocytes through the pachytene stage, perhaps acting after efl-1/dpl-1-mediated gene activation and before gld-1 down-regulation (PubMed:16319922, PubMed:17096596, PubMed:19826475, PubMed:21901106).
May play a role in global X chromosome reactivation or be indirectly required for progression of germ cells through meiosis to the point where X reactivation occurs (PubMed:17096596).
In oocytes, inhibits the activity of the chloride channel clh-3, likely by activating gck-3 (PubMed:21160027).
Plays a role in response to M.nematophilum-mediated bacterial infection by promoting tail swelling and preventing constipation (PubMed:15268855).
Involved in fluid homeostasis (PubMed:11689700).
In addition, involved in the up-regulation of lysozyme ilys-3 expression in the intestine in responses to M.nematophilum-mediated bacterial infection (PubMed:27525822).
By phosphorylating transcription factor skn-1 (isoform c) may play a role in increasing life span downstream of lin-45, let-60 and mek-2 (PubMed:20624915).
By up-regulating cep-1 and down-regulating gld-1 expression in the late pachytene stage, plays a role in germline apoptosis in response to DNA damage (PubMed:21901106).
Regulates egl-1 expression in response to DNA damage, probably upstream of cep-1 (PubMed:21901106).
Plays a negative role in proximal germline proliferation in the mitotic zone (PubMed:16319922).
Required for progression of developing oocytes through the pachytene stage, perhaps acting after efl-1/dpl-1-mediated gene activation and before gld-1 down-regulation (PubMed:16319922, PubMed:17096596, PubMed:19826475, PubMed:21901106).
May play a role in global X chromosome reactivation or be indirectly required for progression of germ cells through meiosis to the point where X reactivation occurs (PubMed:17096596).
In oocytes, inhibits the activity of the chloride channel clh-3, likely by activating gck-3 (PubMed:21160027).
Plays a role in response to M.nematophilum-mediated bacterial infection by promoting tail swelling and preventing constipation (PubMed:15268855).
Involved in fluid homeostasis (PubMed:11689700).
In addition, involved in the up-regulation of lysozyme ilys-3 expression in the intestine in responses to M.nematophilum-mediated bacterial infection (PubMed:27525822).
By phosphorylating transcription factor skn-1 (isoform c) may play a role in increasing life span downstream of lin-45, let-60 and mek-2 (PubMed:20624915).
By up-regulating cep-1 and down-regulating gld-1 expression in the late pachytene stage, plays a role in germline apoptosis in response to DNA damage (PubMed:21901106).
Regulates egl-1 expression in response to DNA damage, probably upstream of cep-1 (PubMed:21901106).
Isoform b
Suppresses germline tumor formation by preventing the dedifferentiation of secondary spermatocytes probably upstream of rskn-1.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Activity regulation
Activated by dual phosphorylation at Thr-256 and Tyr-258 (PubMed:20624915).
May be inactivated by lip-1-mediated dephosphorylation (PubMed:21901106).
May be inactivated by lip-1-mediated dephosphorylation (PubMed:21901106).
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | MAP kinase activity | |
Molecular Function | metal ion binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | cell surface receptor signaling pathway | |
Biological Process | defense response to Gram-positive bacterium | |
Biological Process | determination of adult lifespan | |
Biological Process | intracellular signal transduction | |
Biological Process | MAPK cascade | |
Biological Process | meiotic cell cycle | |
Biological Process | oocyte maturation | |
Biological Process | positive regulation of proteasomal ubiquitin-dependent protein catabolic process | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | Ras protein signal transduction | |
Biological Process | vulval development |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMitogen-activated protein kinase mpk-1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP39745
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown causes an increase in the number of germline cells in the mitotic zone, a lack of transition zone and a defect in pachytene progression resulting in a proximal gonad devoid of nuclei (PubMed:16319922, PubMed:19826475).
Causes sterility (PubMed:19826475).
RNAi-mediated knockdown in adults decreases lifespan (PubMed:20624915).
RNAi-mediated knockdown of isoform b in lip-1 and puf-8 double mutant causes a decrease in number of germline tumors (PubMed:22820175).
RNAi-mediated knockdown causes a reduction in intestinal ilys-3 expression in response to M.nematophilum-mediated bacterial infection (PubMed:27525822).
Causes sterility (PubMed:19826475).
RNAi-mediated knockdown in adults decreases lifespan (PubMed:20624915).
RNAi-mediated knockdown of isoform b in lip-1 and puf-8 double mutant causes a decrease in number of germline tumors (PubMed:22820175).
RNAi-mediated knockdown causes a reduction in intestinal ilys-3 expression in response to M.nematophilum-mediated bacterial infection (PubMed:27525822).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 106 | In ku1; loss of function and ATP-binding. Lack of tail swelling, severe constipation and loss of ilys-3 expression up-regulation following M.nematophilium infection. | ||||
Sequence: A → V | ||||||
Mutagenesis | 216 | In ga111; at the restrictive temperature of 25 degrees Celsius, causes an increase in gld-1 expression and a loss of cep-1 expression in late pachytene germ cells. Loss of egl-1 mRNA expression in response to gamma irradiation. 70 percent of mutants have germ cells arrested at the pachytene stage; phenotype is reversible and meiosis can resume. At the somewhat permissive temperature of 20 degrees Celsius has reduced live brood size; brood size further decreased in pzf-1 mutant background. At the restrictive temperature of 26 degrees Celsius, are completely sterile. Partial phosphorylation at Thr-256 and Tyr-258. | ||||
Sequence: V → G |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000186306 | 1-444 | Mitogen-activated protein kinase mpk-1 | |||
Sequence: MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQQKWQYTRSGHRKMADGEAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKEKLKELIWEEAEAHHRRMEAEAAARNNGGQNPV | ||||||
Modified residue | 256 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 258 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Isoform a is phosphorylated at the pachytene stage during oogenesis and is negatively regulated by gck-1. Isoform b is phosphorylated in proximal oocytes.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in cells lining the rectum (PubMed:15268855, PubMed:20624915).
Isoform a is expressed in nervous system, body wall muscles and posterior intestine (PubMed:20624915).
Isoform b expression may be restricted to germline (PubMed:22820175).
Isoform a is expressed in nervous system, body wall muscles and posterior intestine (PubMed:20624915).
Isoform b expression may be restricted to germline (PubMed:22820175).
Developmental stage
The phosphorylated form is present in early to mid pachytene, is absent in late pachytene and diplotene/diakinesis stages and is again present in oocytes when they reach the spermatheca (PubMed:19826475, PubMed:21901106, PubMed:22820175).
The phosphorylated form is also present in sperm (PubMed:22820175).
The phosphorylated form is also present in sperm (PubMed:22820175).
Gene expression databases
Interaction
Subunit
Isoform a interacts with gck-1 (via N-terminus).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P39745 | gla-3 O02289 | 3 | EBI-321013, EBI-317795 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-56 | Disordered | ||||
Sequence: MPTWIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGSLAYRNSSNIPNGATNHVRQ | ||||||
Domain | 96-384 | Protein kinase | ||||
Sequence: YVNLSYIGEGAYGMVASALDTITRDRVAIKKISPFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQTDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLSNRPLFPGKHYLDQLNLILAVVGSPSNADLQCIINDKARSYLISLPHKPKQPWARLYPGADPRALDLLDKMLTFNPHNRIDIEQALAHPYL | ||||||
Motif | 256-258 | TXY | ||||
Sequence: TEY |
Domain
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Sequence similarities
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P39745-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Nameb
- Length444
- Mass (Da)50,663
- Last updated2002-11-25 v2
- Checksum11BA27D17641980D
P39745-2
- Namea
- Differences from canonical
- 1-68: Missing
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_004848 | 1-68 | in isoform a | |||
Sequence: Missing | ||||||
Sequence conflict | 9-10 | in Ref. 2; AAA18956 | ||||
Sequence: LC → FF |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U03879 EMBL· GenBank· DDBJ | AAA18956.1 EMBL· GenBank· DDBJ | mRNA | ||
U27124 EMBL· GenBank· DDBJ | AAA73482.1 EMBL· GenBank· DDBJ | mRNA | ||
Z46937 EMBL· GenBank· DDBJ | CAA87057.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z46937 EMBL· GenBank· DDBJ | CAB60996.1 EMBL· GenBank· DDBJ | Genomic DNA |