P39724 · BOL3_YEAST
- ProteinBolA-like protein 3
- GeneBOL3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids118 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates [4Fe-4S] cluster insertion into a subset of mitochondrial proteins such as lipoyl synthase (LS) and succinate dehydrogenase (SDH) (PubMed:27532772, PubMed:27532773).
Required during the last step of iron-sulfur protein assembly when the iron-sulfur cluster is inserted into the target protein (PubMed:27532772).
Acts together with NFU1, later than BOL1 and GRX5 in the [4Fe-4S] cluster insertion process (PubMed:27532773).
Not required for [2Fe-2S] cluster insertion into mitochondrial proteins (PubMed:27532772).
Required during the last step of iron-sulfur protein assembly when the iron-sulfur cluster is inserted into the target protein (PubMed:27532772).
Acts together with NFU1, later than BOL1 and GRX5 in the [4Fe-4S] cluster insertion process (PubMed:27532773).
Not required for [2Fe-2S] cluster insertion into mitochondrial proteins (PubMed:27532772).
Miscellaneous
Present with 259 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | iron-sulfur cluster assembly complex | |
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Biological Process | intracellular iron ion homeostasis | |
Biological Process | iron-sulfur cluster assembly | |
Biological Process | protein maturation by [4Fe-4S] cluster transfer |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBolA-like protein 3
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP39724
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Increases frequency of mitochondrial genome loss (PubMed:19300474).
Cells show a slight decrease of succinate dehydrogenase (SDH) (PubMed:27532772).
Cells lacking BOL1 and BOL3 display defects in a subset of mitochondrial [4Fe-4S] enzymes (PubMed:27532772, PubMed:27532773).
Cells show a slight decrease of succinate dehydrogenase (SDH) (PubMed:27532772).
Cells lacking BOL1 and BOL3 display defects in a subset of mitochondrial [4Fe-4S] enzymes (PubMed:27532772, PubMed:27532773).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 64 | Partial loss of function. | ||||
Sequence: C → A | ||||||
Mutagenesis | 101 | Loss of function. | ||||
Sequence: H → A | ||||||
Mutagenesis | 101 | Dominant negative mutant; displays respiratory defects that are higher than the BOL1 BOL3 double mutant. | ||||
Sequence: H → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000201239 | 1-118 | BolA-like protein 3 | |||
Sequence: MKLPQTMLRSISVKHVRWPRILTGSKLWYSTQMAMTPEEKMITDKLQQELEPEVCKVQDVSGGCGSMFAINITSKKFNGLSLIKQHQLVNRILRDDISRWHGLQLTTKKSTGKGPASS |
Proteomic databases
Interaction
Structure
Sequence
- Sequence statusComplete
- Length118
- Mass (Da)13,356
- Last updated1995-02-01 v1
- Checksum244F5FF2052FF410
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U12980 EMBL· GenBank· DDBJ | AAC04985.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006935 EMBL· GenBank· DDBJ | DAA06940.1 EMBL· GenBank· DDBJ | Genomic DNA |