P38960 · STN1_YEAST
- ProteinProtein STN1
- GeneSTN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids494 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a role in telomere length regulation and telomere end protection. Acts as an inhibitor of telomerase loading through its interaction with CDC13.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 62-159 | OB | ||||
Sequence: MLFWKNHPLQQIHLIGCIIGLQFKWIGKQEYIFFQLDDCTSDSSLVGYTSDMRFLTCKVKKDSILSWGLNITDLIGLTLHVYGQASLNYQELQVEYLR |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | CST complex | |
Molecular Function | single-stranded telomeric DNA binding | |
Molecular Function | translation elongation factor binding | |
Biological Process | negative regulation of telomere maintenance via telomerase | |
Biological Process | regulation of telomere maintenance via telomerase | |
Biological Process | telomere capping |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein STN1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38960
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 397 | Modest telomere elongation phenotype. | ||||
Sequence: D → A | ||||||
Mutagenesis | 466 | Elongated telomeres. | ||||
Sequence: W → E | ||||||
Mutagenesis | 466 | Elongated telomeres and severe growth defects. | ||||
Sequence: W → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072279 | 1-494 | Protein STN1 | |||
Sequence: MDKYGHIAHQEGDVCYYIPRLFKYNSYYSGTEDVRIFVGDLKYRMRVSLQICEKYYDRRLSMLFWKNHPLQQIHLIGCIIGLQFKWIGKQEYIFFQLDDCTSDSSLVGYTSDMRFLTCKVKKDSILSWGLNITDLIGLTLHVYGQASLNYQELQVEYLRLCYSLTEEIDHWKITMNMREQLDTPWSLSDFVIGELFTQEQEWTPETSQIEVVNPDFVGIGYKTPESKRNETTFIEQLQEERLKDELEIISPYNSTDTSNSVHSLSFRFVSSLKDFPETHFLNSGDQIDNGNDEQLKKLEYQSANLPVMIPNRTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with CDC13 and TEN1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38960 | CDC13 P32797 | 10 | EBI-18427, EBI-4187 | |
BINARY | P38960 | POL12 P38121 | 2 | EBI-18427, EBI-6111 | |
BINARY | P38960 | TEN1 Q07921 | 12 | EBI-18427, EBI-35131 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 311-397 | Winged helix-turn-helix (wHTH) 1 | ||||
Sequence: NRTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFD | ||||||
Region | 396-494 | Winged helix-turn-helix (wHTH) 2 | ||||
Sequence: FDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS |
Domain
The C-terminal wHLH region seems to mediate telomere-specific function.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length494
- Mass (Da)57,511
- Last updated1995-02-01 v1
- Checksum61B691C8D4A2E650
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF002132 EMBL· GenBank· DDBJ | AAB60885.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X82086 EMBL· GenBank· DDBJ | CAA57609.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z46796 EMBL· GenBank· DDBJ | CAA86804.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74378 EMBL· GenBank· DDBJ | CAA98902.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY723774 EMBL· GenBank· DDBJ | AAU09691.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA11929.1 EMBL· GenBank· DDBJ | Genomic DNA |