P38953 · RAD55_YEAST
- ProteinDNA repair protein RAD55
- GeneRAD55
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids406 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for radiation resistance and meiotic viability and presumably acts in recombination and recombinational DNA repair pathways.
Miscellaneous
Present with 1050 molecules/cell in log phase SD medium.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Rad51B-Rad51C-Rad51D-XRCC2 complex | |
Cellular Component | Rad51C-XRCC3 complex | |
Cellular Component | replication fork | |
Molecular Function | ATP binding | |
Molecular Function | ATP-dependent activity, acting on DNA | |
Molecular Function | ATP-dependent DNA damage sensor activity | |
Molecular Function | DNA binding | |
Biological Process | DNA recombinase assembly | |
Biological Process | double-strand break repair | |
Biological Process | error-free postreplication DNA repair | |
Biological Process | heteroduplex formation | |
Biological Process | meiotic DNA recombinase assembly | |
Biological Process | positive regulation of single-strand break repair via homologous recombination | |
Biological Process | reciprocal meiotic recombination |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA repair protein RAD55
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38953
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000122954 | 1-406 | DNA repair protein RAD55 | |||
Sequence: MSLGIPLSQLIVESPKPLSSGITGLDEILNLGFQARSIYEIFGPPGIGKTNFGIQLVCNSLEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVEENVKRVRITKFGQLLYFFQNLFKLSQSVRYKLVIIDGFSQLVCDHLCTLSKRGGGMIDKTIHELKCRHLILIFTVMTKYTHSTGSTIIVLNDCMNTAFQSNEFESLEEYYEILDDGSNFFVNSNNERRKNNVHILKSALVANIAMGSKDSTWEVFLRDRIGLFRDWNEQVDETVFVKSKRVKASSSQSNEGCTTIKEMRINKRNFENLRIAIVFNLHGEDRKREGRNLKRSRSSDDRNYIVKFDFDKATGQLRDIIDLKPDTANIASFPTLSTSSSSCSQVFNNIDSNDNPLPNAEGKEEIIYDSEG |
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38953 | RAD51 P25454 | 6 | EBI-14737, EBI-14709 | |
BINARY | P38953 | RAD57 P25301 | 10 | EBI-14737, EBI-14744 | |
BINARY | P38953 | SRS2 P12954 | 4 | EBI-14737, EBI-18110 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 385-406 | Disordered | ||||
Sequence: DSNDNPLPNAEGKEEIIYDSEG |
Sequence similarities
Belongs to the RecA family. RAD55 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length406
- Mass (Da)46,350
- Last updated1995-02-01 v1
- Checksum8EA49831F7F3E098
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 110 | in Ref. 2; AAA19688 | ||||
Sequence: F → L | ||||||
Sequence conflict | 197 | in Ref. 2; AAA19688 | ||||
Sequence: F → N |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z46796 EMBL· GenBank· DDBJ | CAA86798.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D10481 EMBL· GenBank· DDBJ | BAA01284.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U01144 EMBL· GenBank· DDBJ | AAA19688.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X82086 EMBL· GenBank· DDBJ | CAA57603.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74372 EMBL· GenBank· DDBJ | CAA98895.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY723773 EMBL· GenBank· DDBJ | AAU09690.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA11922.1 EMBL· GenBank· DDBJ | Genomic DNA |