P38873 · KOG1_YEAST
- ProteinTarget of rapamycin complex 1 subunit KOG1
- GeneKOG1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1557 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of TORC1, which regulates multiple cellular processes to control cell growth in response to environmental signals. Nutrient limitation and environmental stress signals cause inactivation of TORC1. Active TORC1 positively controls ribosome biogenesis via control of rRNA, ribosomal protein and tRNA gene expression, and rRNA processing. TORC1 positively controls protein biosynthesis by regulation of mRNA stability, translation initiation factor activity, and high-affinity amino acid permeases that serve to provide amino acids for use by the translation machinery. TORC1 also promotes growth by sequestering a number of nutrient and general stress-responsive transcription factors in the cytoplasm. TORC1 negatively controls macroautophagy, a process to recycle surplus cytoplasmic mass under nutrient starvation conditions. KOG1 may have a role in binding and recruiting substrates of TORC1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic stress granule | |
Cellular Component | fungal-type vacuole membrane | |
Cellular Component | mitochondrion | |
Cellular Component | plasma membrane | |
Cellular Component | TORC1 complex | |
Molecular Function | protein-macromolecule adaptor activity | |
Molecular Function | ubiquitin binding | |
Biological Process | cellular response to amino acid stimulus | |
Biological Process | cellular response to starvation | |
Biological Process | positive regulation of cell growth | |
Biological Process | regulation of autophagy | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of cell growth | |
Biological Process | response to nutrient | |
Biological Process | TOR signaling |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTarget of rapamycin complex 1 subunit KOG1
- Short namesTORC1 subunit KOG1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38873
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Vacuole membrane ; Peripheral membrane protein
Note: Also localizes to membranous structures within the cell interior, probably endosomal or Golgi membranes.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051476 | 1-1557 | Target of rapamycin complex 1 subunit KOG1 | |||
Sequence: MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIFLMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELWLKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNTGAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQNQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPLINDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQGSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSKAHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQSLGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPLNSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWSKKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDLKLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVESFVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVTSTLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF |
Proteomic databases
PTM databases
Interaction
Subunit
The target of rapamycin complex 1 (TORC1) is composed of at least KOG1, LST8, TCO89 and either TOR1 (TORC1-A) or TOR2 (TORC1-B) (PubMed:12408816, PubMed:12631735, PubMed:16394584).
Interacts with PIB2; following activation of PIB2 by glutamine or cysteine (PubMed:29698392).
TORC1 binds to and is inhibited by FKBP-rapamycin (PubMed:12408816).
Interacts with PIB2; following activation of PIB2 by glutamine or cysteine (PubMed:29698392).
TORC1 binds to and is inhibited by FKBP-rapamycin (PubMed:12408816).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38873 | KSP1 P38691 | 4 | EBI-24864, EBI-9937 | |
BINARY | P38873 | LST8 P41318 | 3 | EBI-24864, EBI-28598 | |
BINARY | P38873 | TOR1 P35169 | 7 | EBI-24864, EBI-19374 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 548-586 | HEAT 1 | ||||
Sequence: RHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVY | ||||||
Repeat | 588-625 | HEAT 2 | ||||
Sequence: SLSIGIFPYVLKLLQSPAPELKPILVFIWARIMSIDYK | ||||||
Repeat | 777-814 | HEAT 3 | ||||
Sequence: CMNTGAVEILLKSLKDPVPEVRTASIFALKHFISGFQD | ||||||
Repeat | 888-925 | HEAT 4 | ||||
Sequence: RQEIGNLISILPLINDGSSLVRKELVVYFSHIVSRYSN | ||||||
Region | 1084-1114 | Disordered | ||||
Sequence: SESNSDSDTQSSNTSMKSHTSKKGPSGLYLL | ||||||
Repeat | 1207-1248 | WD 1 | ||||
Sequence: NNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFS | ||||||
Repeat | 1252-1293 | WD 2 | ||||
Sequence: PFGTKVTDLKLINEDDSALLLTGSSDGVIKIYRDYQDVDTFK | ||||||
Repeat | 1296-1346 | WD 3 | ||||
Sequence: SAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAHTETVEVD | ||||||
Repeat | 1350-1390 | WD 4 | ||||
Sequence: KTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSM | ||||||
Repeat | 1400-1440 | WD 5 | ||||
Sequence: KQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES | ||||||
Repeat | 1452-1492 | WD 6 | ||||
Sequence: SQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFK | ||||||
Repeat | 1517-1557 | WD 7 | ||||
Sequence: TSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF |
Sequence similarities
Belongs to the WD repeat RAPTOR family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,557
- Mass (Da)177,609
- Last updated2007-01-09 v2
- ChecksumB927EE93700176D3
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U00030 EMBL· GenBank· DDBJ | AAB68364.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
BK006934 EMBL· GenBank· DDBJ | DAA06878.1 EMBL· GenBank· DDBJ | Genomic DNA |