P38822 · BZZ1_YEAST
- ProteinProtein BZZ1
- GeneBZZ1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids633 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in endocytosis and trafficking to the vacuole. Functions with type I myosins to restore polarity of the actin cytoskeleton after NaCl stress.
Miscellaneous
Present with 5440 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin cortical patch | |
Cellular Component | cellular bud neck | |
Cellular Component | cytoplasm | |
Cellular Component | mating projection tip | |
Cellular Component | plasma membrane | |
Molecular Function | enzyme activator activity | |
Molecular Function | phospholipid binding | |
Biological Process | actin filament organization | |
Biological Process | actin nucleation | |
Biological Process | endocytosis | |
Biological Process | regulation of actin filament polymerization | |
Biological Process | response to salt stress |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein BZZ1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38822
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: localizes in cortical actin patches in a LAS17-dependent manner.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000065033 | 1-633 | Protein BZZ1 | |||
Sequence: MSADLSIGNEIKDSFKETHKWVQNNLKWLKDIEQFYRERAKLEKDYSERLSRLSAEYFNKKSSTSVPISVGDTPTTTPGSIEAAGVVAWNEILSQTDMISKDHDQLSTDFENHVANQLSGLFTKLDMTLSKINGFNNDMVNKKDNIYHELEKAKKDYDEACSTMEMARNRYTKASNDRNKKKLDEKEMEMNKCKNEYLIKINQANRTKDKYYFQDVPEVLDLLQDVNEAKTLFLNDLWLKAASVENDLGANVSKRLQAANSVVKQNKPSLNTAIFIKHNLKNWKEPQDFVYKPSPVWHDDEKFAVPSSLEVEDLRIKLAKAENDYNSLQDKTQNELSKLSTLNKIKHEMKTNEDNINATKFYDTLKEYLNVVSPFTSHETLKLQAEVQIESIQNNVPEEYDLSTDNIDLSKTKKKSGIFSKFKHNILNVDSKPSSGGSTGNGNGGPLHITSLFNTSRRTRLGSAPNNAGEDSDNNSIRTTSTNNTKKTTQNSSDDGKNKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATVKANDRGPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK | ||||||
Modified residue | 327 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 463 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 472 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 476 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with LAS17 and MYO5.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38822 | AIM21 P40563 | 7 | EBI-3889, EBI-25376 | |
BINARY | P38822 | AIM3 P38266 | 2 | EBI-3889, EBI-21584 | |
BINARY | P38822 | APP1 P53933 | 14 | EBI-3889, EBI-28798 | |
BINARY | P38822 | BBC1 P47068 | 2 | EBI-3889, EBI-3437 | |
BINARY | P38822 | LAS17 Q12446 | 17 | EBI-3889, EBI-10022 | |
BINARY | P38822 | LDB17 Q12342 | 4 | EBI-3889, EBI-38872 | |
BINARY | P38822 | MYO5 Q04439 | 5 | EBI-3889, EBI-11687 | |
BINARY | P38822 | UBP7 P40453 | 3 | EBI-3889, EBI-19857 | |
BINARY | P38822 | YPL277C Q08989 | 2 | EBI-3889, EBI-38031 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-271 | F-BAR | ||||
Sequence: LSIGNEIKDSFKETHKWVQNNLKWLKDIEQFYRERAKLEKDYSERLSRLSAEYFNKKSSTSVPISVGDTPTTTPGSIEAAGVVAWNEILSQTDMISKDHDQLSTDFENHVANQLSGLFTKLDMTLSKINGFNNDMVNKKDNIYHELEKAKKDYDEACSTMEMARNRYTKASNDRNKKKLDEKEMEMNKCKNEYLIKINQANRTKDKYYFQDVPEVLDLLQDVNEAKTLFLNDLWLKAASVENDLGANVSKRLQAANSVVKQNKPSLN | ||||||
Coiled coil | 138-210 | |||||
Sequence: DMVNKKDNIYHELEKAKKDYDEACSTMEMARNRYTKASNDRNKKKLDEKEMEMNKCKNEYLIKINQANRTKDK | ||||||
Region | 429-495 | Disordered | ||||
Sequence: VDSKPSSGGSTGNGNGGPLHITSLFNTSRRTRLGSAPNNAGEDSDNNSIRTTSTNNTKKTTQNSSDD | ||||||
Domain | 493-555 | SH3 1 | ||||
Sequence: SDDGKNKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSA | ||||||
Domain | 577-633 | SH3 2 | ||||
Sequence: LPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK |
Sequence similarities
Belongs to the BZZ1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length633
- Mass (Da)71,171
- Last updated1995-02-01 v1
- Checksum5C73DACC69611B41
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 196 | in Ref. 3; AAS56434 | ||||
Sequence: E → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U00059 EMBL· GenBank· DDBJ | AAB68850.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY558108 EMBL· GenBank· DDBJ | AAS56434.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006934 EMBL· GenBank· DDBJ | DAA06808.1 EMBL· GenBank· DDBJ | Genomic DNA |