P38270 · ATG14_YEAST
- ProteinAutophagy-related protein 14
- GeneATG14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids344 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I. This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure. ATG14 mediates the specific binding of the VPS34 PI3-kinase complex I to the preautophagosomal structure (PAS).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | fungal-type vacuole membrane | |
Cellular Component | phagophore assembly site | |
Cellular Component | phagophore assembly site membrane | |
Cellular Component | phosphatidylinositol 3-kinase complex, class III, type I | |
Cellular Component | vacuole-isolation membrane contact site | |
Biological Process | autophagy | |
Biological Process | cellular response to potassium ion starvation | |
Biological Process | cytoplasm to vacuole targeting by the Cvt pathway | |
Biological Process | macroautophagy | |
Biological Process | pexophagy | |
Biological Process | phosphatidylinositol phosphate biosynthetic process | |
Biological Process | piecemeal microautophagy of the nucleus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 14
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38270
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Preautophagosomal structure membrane ; Peripheral membrane protein
Vacuole membrane ; Peripheral membrane protein
Note: TRS85 is required for the recruitment of ATG14 to the PAS.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000212453 | 1-344 | Autophagy-related protein 14 | |||
Sequence: MHCPICHHRAHVVYCAHCINTSPSLLLKLKLDLILLKDENKELNGKVEQILNEAMNYDQLDIKRMEKKKDPLMNSLMKLDVLRMKKNNNLIRHRIEQLNERIYSKRNHISELKVEIDNYKCYKVGTGTDKLREQVEISDAKNKLAQVSKICESARDYKLNLLNNWFVIQKLQDNFQIPFAIAFQPLISLKNFRILPLAITNDSINIMWKYISFFSDILMIKLPYTNKICEQPMFEFSDSIQTVVQRLIKLIINILQICRHLKLVPSTPMDIPWLLDQYDVDGLFYNMVKRNKMKCRSVSLYWTFGMLYSMVLDNMNNPQRGHPARRTAPPPTVTGPHDRWYVVG |
Proteomic databases
Expression
Induction
Nitrogen starvation or rapamycin treatment rapidly causes a more than 20-fold induction of expression. The expression is dependent on GLN3.
Interaction
Subunit
Component of the autophagy-specific VPS34 PI3-kinase complex I composed of VPS15, VPS30, VPS34, ATG14 and ATG38. Interacts directly with ATG38.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38270 | ATG38 Q05789 | 15 | EBI-2699, EBI-35873 | |
BINARY | P38270 | VPS30 Q02948 | 12 | EBI-2699, EBI-2670 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 3-18 | Cysteine repeats | ||||
Sequence: CPICHHRAHVVYCAHC | ||||||
Coiled coil | 25-156 | |||||
Sequence: LLLKLKLDLILLKDENKELNGKVEQILNEAMNYDQLDIKRMEKKKDPLMNSLMKLDVLRMKKNNNLIRHRIEQLNERIYSKRNHISELKVEIDNYKCYKVGTGTDKLREQVEISDAKNKLAQVSKICESARD |
Domain
Coiled-Coils at the N-terminal half are essential for interaction with VPS30 and VPS34 and autophagy.
Sequence similarities
Belongs to the ATG14 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length344
- Mass (Da)40,454
- Last updated1994-10-01 v1
- Checksum202039BC7EC8BB16
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X75891 EMBL· GenBank· DDBJ | CAA53487.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z35997 EMBL· GenBank· DDBJ | CAA85085.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB011071 EMBL· GenBank· DDBJ | BAA32103.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY693167 EMBL· GenBank· DDBJ | AAT93186.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
J04450 EMBL· GenBank· DDBJ | AAA66889.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07245.1 EMBL· GenBank· DDBJ | Genomic DNA |