P38116 · ARL1_YEAST
- ProteinADP-ribosylation factor-like protein 1
- GeneARL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids183 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Recruits golgins such as IMH1 to the Golgi. Can bind and hydrolyze GTP. May be involved in trafficking events within the endosomal system.
Miscellaneous
Present with 5190 molecules/cell in log phase SD medium.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | endosome membrane | |
Cellular Component | Golgi apparatus | |
Cellular Component | phagophore assembly site | |
Cellular Component | trans-Golgi network | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | cellular response to heat | |
Biological Process | cellular response to nitrogen starvation | |
Biological Process | cytoplasm to vacuole targeting by the Cvt pathway | |
Biological Process | endocytosis | |
Biological Process | Golgi to plasma membrane protein transport | |
Biological Process | intracellular protein transport | |
Biological Process | macroautophagy | |
Biological Process | protein localization to Golgi apparatus | |
Biological Process | protein localization to phagophore assembly site | |
Biological Process | protein targeting to vacuole | |
Biological Process | protein-containing complex localization | |
Biological Process | response to endoplasmic reticulum stress | |
Biological Process | trans-Golgi network membrane organization | |
Biological Process | vesicle-mediated transport |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameADP-ribosylation factor-like protein 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38116
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Decreases the physical interaction between MON2 and DOP1.
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000207421 | 2-183 | ADP-ribosylation factor-like protein 1 | |||
Sequence: GNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQL |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Homodimer (PubMed:11535602).
Interacts with IMH1 (via GRIP domain); the interaction is dependent on GTP (PubMed:12620188, PubMed:12620189).
Interacts with MON2 (PubMed:12052896).
Interacts with IMH1 (via GRIP domain); the interaction is dependent on GTP (PubMed:12620188, PubMed:12620189).
Interacts with MON2 (PubMed:12052896).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38116 | IMH1 Q06704 | 3 | EBI-2869, EBI-33343 | |
BINARY | P38116 | VPS53 P47061 | 3 | EBI-2869, EBI-25828 | |
BINARY | P38116 | VPS54 Q12071 | 3 | EBI-2869, EBI-36751 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length183
- Mass (Da)20,434
- Last updated2007-01-23 v4
- Checksum84D0E1F79EC21E38
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U89332 EMBL· GenBank· DDBJ | AAC49875.1 EMBL· GenBank· DDBJ | mRNA | ||
Z36033 EMBL· GenBank· DDBJ | CAA85125.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07280.1 EMBL· GenBank· DDBJ | Genomic DNA |