P38112 · MAK5_YEAST
- ProteinATP-dependent RNA helicase MAK5
- GeneMAK5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids773 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits and is required for the normal formation of 25S and 5.8S rRNAs. Required for the maintenance of dsRNA killer plasmid.
Miscellaneous
Present with 981 molecules/cell in log phase SD medium.
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleolus | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA helicase activity | |
Biological Process | maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | |
Biological Process | maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | |
Biological Process | ribosomal large subunit biogenesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent RNA helicase MAK5
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP38112
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 218 | Delays the appearance and decreases the level of 25S rRNA. | ||||
Sequence: G → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 12 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000055048 | 1-773 | ATP-dependent RNA helicase MAK5 | |||
Sequence: MGKKRAPQKGKTVTKPQEIIVDESKLNWKPVDIPDTLDDFGGFYGLEEIDGVDVKVVDGKVTFVTKKDSKVLKDSNKEKVGDDQESVENESGSDSESELLEFKNLDDIKEGELSAASYSSSDEDEQGNIESSKLTDPSEDVDEDVDEDVLKENVFNKDINIDDISPVNLPEWTNLAPLSMTILQSLQNLNFLRPTEIQKKSIPVIMQGVDVMGKASTGSGKTLAYGIPIVEKLISNFSQKNKKPISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVERRKNRENSEGSSKIWQTLIFSATFSIDLFDKLSSSRQVKDRRFKNNEDELNAVIQHLMSKIHFNSKPVIIDTNPESKVSSQIKESLIECPPLERDLYCYYFLTMFPGTTLIFCNAIDSVKKLTVYLNNLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPDSVQLSTVLIASDVAARGLDIPGVQHVIHYHLPRSTDIYIHRSGRTARAGSEGVSAMICSPQESMGPLRKLRKTLATKNSVSTDLNSRSTNRKPIKWQNTVPLLPIETDILSQLRERSRLAGELADHEIASNSLRKDDNWLKKAADELGIDVDSDEDDISKSNSDTFLLKNKNKKMQKTINKDKVKAMRATLNELLSVPIRKDRRQKYLTGGLVNLADNLVKKRGHNSIIGHEKTNALETLKKKKKRNN | ||||||
Modified residue | 135 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 138 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 678 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P38112 | DBP10 Q12389 | 3 | EBI-10394, EBI-5644 | |
BINARY | P38112 | HAS1 Q03532 | 4 | EBI-10394, EBI-8170 | |
BINARY | P38112 | LOC1 P43586 | 3 | EBI-10394, EBI-22906 | |
BINARY | P38112 | NOP12 Q08208 | 4 | EBI-10394, EBI-35895 | |
BINARY | P38112 | NOP4 P37838 | 5 | EBI-10394, EBI-12122 | |
BINARY | P38112 | RLP7 P40693 | 3 | EBI-10394, EBI-15415 | |
BINARY | P38112 | RPF1 P38805 | 3 | EBI-10394, EBI-24614 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 73-99 | Disordered | ||||
Sequence: KDSNKEKVGDDQESVENESGSDSESEL | ||||||
Region | 114-144 | Disordered | ||||
Sequence: SAASYSSSDEDEQGNIESSKLTDPSEDVDED | ||||||
Motif | 171-199 | Q motif | ||||
Sequence: EWTNLAPLSMTILQSLQNLNFLRPTEIQK | ||||||
Domain | 202-399 | Helicase ATP-binding | ||||
Sequence: IPVIMQGVDVMGKASTGSGKTLAYGIPIVEKLISNFSQKNKKPISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVERRKNRENSEGSSKIWQTLIFSATFSIDLFDKLSSSRQVKDRR | ||||||
Motif | 333-336 | DEAD box | ||||
Sequence: DEAD | ||||||
Domain | 452-615 | Helicase C-terminal | ||||
Sequence: DLYCYYFLTMFPGTTLIFCNAIDSVKKLTVYLNNLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPDSVQLSTVLIASDVAARGLDIPGVQHVIHYHLPRSTDIYIHRSGRTARAGSEGVSAMICSPQESMGPLRKLRKTLATKNSVSTDLNSRSTN |
Domain
The Q motif is unique to and characteristic of the DEAD box family of RNA helicases and controls ATP binding and hydrolysis.
Sequence similarities
Belongs to the DEAD box helicase family. DDX24/MAK5 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length773
- Mass (Da)87,048
- Last updated1994-10-01 v1
- ChecksumC4FF2FB5B04FFBF9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z36011 EMBL· GenBank· DDBJ | CAA85100.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X78937 EMBL· GenBank· DDBJ | CAA55539.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07258.1 EMBL· GenBank· DDBJ | Genomic DNA |