P36575 · ARRC_HUMAN
- ProteinArrestin-C
- GeneARR3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids388 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in an as yet undefined retina-specific signal transduction. Could bind to photoactivated-phosphorylated red/green opsins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | photoreceptor inner segment | |
Cellular Component | photoreceptor outer segment | |
Cellular Component | synapse | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | opsin binding | |
Molecular Function | phosphoprotein binding | |
Biological Process | G protein-coupled receptor internalization | |
Biological Process | regulation of protein phosphorylation | |
Biological Process | signal transduction | |
Biological Process | visual perception |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameArrestin-C
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP36575
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Myopia 26, X-linked, female-limited (MYP26)
- Note
- DescriptionA form of myopia, a refractive error of the eye, in which parallel rays from a distant object come to focus in front of the retina, vision being better for near objects than for far. MYP26 is characterized by typical tigroid fundus changes commonly seen in early onset high myopia, and an unusual pattern of X-linked female-limited inheritance.
- See alsoMIM:301010
Natural variants in MYP26
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_080595 | 80 | L>P | in MYP26; uncertain significance; dbSNP:rs1555941116 | |
VAR_080596 | 100-388 | missing | in MYP26; uncertain significance | |
VAR_080597 | 298 | A>D | in MYP26; uncertain significance; dbSNP:rs765658563 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_025520 | 44 | in dbSNP:rs11548182 | |||
Sequence: L → F | ||||||
Natural variant | VAR_080595 | 80 | in MYP26; uncertain significance; dbSNP:rs1555941116 | |||
Sequence: L → P | ||||||
Natural variant | VAR_080596 | 100-388 | in MYP26; uncertain significance | |||
Sequence: Missing | ||||||
Natural variant | VAR_080597 | 298 | in MYP26; uncertain significance; dbSNP:rs765658563 | |||
Sequence: A → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 303 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000205203 | 1-388 | Arrestin-C | |||
Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGEEESQKAVEAEGDEGS |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Inner and outer segments, and the inner plexiform regions of the retina.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homodimer; disulfide-linked in response to retinal illumination (By similarity).
Interacts with CXCR4; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates the calcium ion mobilization activity of CXCR4 (PubMed:20048153).
Interacts with GPR84 (PubMed:35427647).
Interacts with CXCR4; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates the calcium ion mobilization activity of CXCR4 (PubMed:20048153).
Interacts with GPR84 (PubMed:35427647).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P36575 | PLK4 O00444 | 3 | EBI-718116, EBI-746202 | |
BINARY | P36575 | ZBTB43 O43298 | 3 | EBI-718116, EBI-740718 | |
BINARY | P36575 | ZNF496 Q96IT1 | 6 | EBI-718116, EBI-743906 | |
BINARY | P36575-2 | MARCHF8 Q5T0T0 | 3 | EBI-11977533, EBI-14061946 | |
BINARY | P36575-2 | ZNF496 Q96IT1 | 3 | EBI-11977533, EBI-743906 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P36575-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length388
- Mass (Da)42,778
- Last updated2006-03-07 v2
- Checksum491F4EE4EE1ADA0D
P36575-2
- Name2
- Differences from canonical
- 359-388: SSEDIVIEEFTRKGEEESQKAVEAEGDEGS → R
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6RCT3 | D6RCT3_HUMAN | ARR3 | 97 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 19 | in Ref. 7; CAG33130 | ||||
Sequence: G → V | ||||||
Sequence conflict | 93 | in Ref. 1; no nucleotide entry and 4; AAB84302/AAC27524 | ||||
Sequence: P → A | ||||||
Sequence conflict | 217 | in Ref. 2; AAC78395 | ||||
Sequence: I → V | ||||||
Sequence conflict | 356-357 | in Ref. 8; AL357752 | ||||
Sequence: EA → AS | ||||||
Alternative sequence | VSP_017495 | 359-388 | in isoform 2 | |||
Sequence: SSEDIVIEEFTRKGEEESQKAVEAEGDEGS → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U03626 EMBL· GenBank· DDBJ | AAC78395.1 EMBL· GenBank· DDBJ | mRNA | ||
AF033105 EMBL· GenBank· DDBJ | AAB84302.1 EMBL· GenBank· DDBJ | mRNA | ||
AF076512 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076497 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076498 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076499 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076500 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076501 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076502 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076503 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076504 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076505 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076506 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076507 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076508 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076509 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076510 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF076511 EMBL· GenBank· DDBJ | AAC27524.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EU883571 EMBL· GenBank· DDBJ | ACG60645.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456849 EMBL· GenBank· DDBJ | CAG33130.1 EMBL· GenBank· DDBJ | mRNA | ||
AL357752 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC012096 EMBL· GenBank· DDBJ | AAH12096.1 EMBL· GenBank· DDBJ | mRNA |