P36397 · ARF1_ARATH
- ProteinADP-ribosylation factor 1
- GeneARF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids181 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GTP-binding protein involved in protein trafficking; required for the sequence-specific vacuolar sorting route to the lytic vacuole, for the ER-to-Golgi transport and for the Golgi-derived transport to the plasma membrane (PubMed:24369434).
Involved in the recruitment of COPI and GDAP1 to membranes. Required for recycling of PIN auxin transporters (e.g. PIN1 and PIN2) in a fungal toxin brefeldin A (BFA)-dependent manner. Involved in various auxin-dependent developmental processes (PubMed:24369434).
Involved in the recruitment of COPI and GDAP1 to membranes. Required for recycling of PIN auxin transporters (e.g. PIN1 and PIN2) in a fungal toxin brefeldin A (BFA)-dependent manner. Involved in various auxin-dependent developmental processes (PubMed:24369434).
Catalytic activity
- GTP + H2O = GDP + H+ + phosphate
Activity regulation
Activated by AGD7 and AGD10.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | early endosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | trans-Golgi network | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | mRNA binding | |
Molecular Function | phospholipase activator activity | |
Biological Process | auxin-activated signaling pathway | |
Biological Process | protein transport | |
Biological Process | regulation of auxin metabolic process | |
Biological Process | response to brefeldin A | |
Biological Process | vesicle-mediated transport to the plasma membrane |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameADP-ribosylation factor 1
- EC number
- Short namesAtARF1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP36397
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with AGD5 at trans-Golgi network.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 31 | Constitutively inactive form (GDP-locked form); loss of intracellular protein trafficking. | ||||
Sequence: T → N | ||||||
Mutagenesis | 34 | In bex1; hypersensitivity to the fungal toxin brefeldin A (BFA) leading to developmental defects (including embryonic patterning defects, root bending and growth arrest) and impaired plasma membrane localization of PIN auxin transporters (e.g. PIN1 and PIN2), thus conferring abnormal auxin response gradient. Normal subcellular localization. | ||||
Sequence: L → F | ||||||
Mutagenesis | 71 | Constitutively active form (GTP-locked form). | ||||
Sequence: Q → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000207426 | 2-181 | ADP-ribosylation factor 1 | |||
Sequence: GLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length181
- Mass (Da)20,609
- Last updated2007-01-23 v2
- Checksum7EDDEC87B7B29592
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M95166 EMBL· GenBank· DDBJ | AAA32729.1 EMBL· GenBank· DDBJ | mRNA | ||
AC002337 EMBL· GenBank· DDBJ | AAB63817.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC007236 EMBL· GenBank· DDBJ | AAM15469.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC10810.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM62132.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM62133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY074859 EMBL· GenBank· DDBJ | AAL75910.1 EMBL· GenBank· DDBJ | mRNA | ||
AY142032 EMBL· GenBank· DDBJ | AAM98296.1 EMBL· GenBank· DDBJ | mRNA | ||
AY087342 EMBL· GenBank· DDBJ | AAM64892.1 EMBL· GenBank· DDBJ | mRNA |