P36075 · CUE2_YEAST
- ProteinEndonuclease CUE2
- GeneCUE2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids443 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
mRNA endonuclease involved in the No-Go Decay (NGD) pathway, which catalyzes mRNA cleavage and degradation in response to ribosome collisions (PubMed:31219035, PubMed:36583309).
Acts downstream of the ribosome collision sensor HEL2 (PubMed:36583309).
Specifically recognizes and binds RPS7/eS7 polyubiquitinated by MOT2/NOT4 and HEL2, promoting CUE2 recruitment to stalled ribosomes, where it mediates mRNA cleavage upstream of the colliding ribosome (PubMed:36583309).
Also mediates mRNA cleavage within colliding ribosomes: recruited to colliding ribosomes downstream of the RQT (ribosome quality control trigger) complex following disassembly of stalled ribosomes and cleaves mRNAs partially released from the colliding ribosome (PubMed:36583309).
Acts downstream of the ribosome collision sensor HEL2 (PubMed:36583309).
Specifically recognizes and binds RPS7/eS7 polyubiquitinated by MOT2/NOT4 and HEL2, promoting CUE2 recruitment to stalled ribosomes, where it mediates mRNA cleavage upstream of the colliding ribosome (PubMed:36583309).
Also mediates mRNA cleavage within colliding ribosomes: recruited to colliding ribosomes downstream of the RQT (ribosome quality control trigger) complex following disassembly of stalled ribosomes and cleaves mRNAs partially released from the colliding ribosome (PubMed:36583309).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosolic ribosome | |
Molecular Function | endonuclease activity | |
Molecular Function | K63-linked polyubiquitin modification-dependent protein binding | |
Molecular Function | polyubiquitin modification-dependent protein binding | |
Molecular Function | RNA endonuclease activity | |
Molecular Function | ubiquitin binding | |
Biological Process | nuclear-transcribed mRNA catabolic process, no-go decay | |
Biological Process | rescue of stalled ribosome |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEndonuclease CUE2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP36075
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 20-21 | In CUE-D1 mutant; impaired ability to bind polyubiquitinated RPS7/eS7; when associated with 46-A-A-47. | ||||
Sequence: FP → AA | ||||||
Mutagenesis | 46-47 | In CUE-D1 mutant; impaired ability to bind polyubiquitinated RPS7/eS7; when associated with 21-A-A-22. | ||||
Sequence: LL → AA | ||||||
Mutagenesis | 67-68 | In CUE-D2 mutant; impaired ability to bind polyubiquitinated RPS7/eS7; when associated with 93-A-A-94. | ||||
Sequence: FP → AA | ||||||
Mutagenesis | 93-94 | In CUE-D2 mutant; impaired ability to bind polyubiquitinated RPS7/eS7; when associated with 66-A-A-67. | ||||
Sequence: LL → AA | ||||||
Mutagenesis | 122 | Abolished ability to act downstream of the RQT (ribosome quality control trigger) complex. | ||||
Sequence: W → A | ||||||
Mutagenesis | 348-350 | Abolished mRNA endonuclease activity. | ||||
Sequence: DFH → AAA | ||||||
Mutagenesis | 402 | Decreased ability to participate to No-Go Decay (NGD) pathway in response to ribosome collision. | ||||
Sequence: R → A | ||||||
Mutagenesis | 402 | No effect. | ||||
Sequence: R → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 12 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000079558 | 1-443 | Endonuclease CUE2 | |||
Sequence: MSMDNNDDHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKENDDKSTVDNELHQLYDMFPQLDCSVIKDQFVINEKSVESTISDLLNYETLQKLKDNQANSPDSVKRNEKKNNWESTNDHIESIIKFTDAPKNIAQEYLAENGFDTVKAIIKIILDYYDKRDFKKDVDTFKVKRSPNTTVRGGRVQSSTGLAHVLKKGKESANVAQESLKRPRSYKHSLDSPQMVELNELVADNRDLKAINHEFLQKCLQFYDGDVVKVLNISSLLIEDDKNITKTWNFDEGFTLTSRDNCKQHLPKFSTPQISRRNEVGNTYKLPLHDKETPEGAVPVINNLFQTYRLDFHGFLPSEAVSTLKLALNKWWSKEVAERELNSHNINSYGSKVQFVSPLIVVTGRGIHSIGGISKVRLQVKSFLEKNHYIFWEESSYFRIEGKKKK |
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-51 | CUE 1 | ||||
Sequence: DHESKLSILMDMFPAISKSKLQVHLLENNNDLDLTIGLLLKEND | ||||||
Domain | 55-98 | CUE 2 | ||||
Sequence: TVDNELHQLYDMFPQLDCSVIKDQFVINEKSVESTISDLLNYET | ||||||
Domain | 347-443 | Smr | ||||
Sequence: LDFHGFLPSEAVSTLKLALNKWWSKEVAERELNSHNINSYGSKVQFVSPLIVVTGRGIHSIGGISKVRLQVKSFLEKNHYIFWEESSYFRIEGKKKK |
Domain
The CUE domains specifically bind RPS7/eS7 polyubiquitinated by MOT2/NOT4 and HEL2.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length443
- Mass (Da)50,874
- Last updated1994-06-01 v1
- Checksum8B7BB872C2BDC734
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z28090 EMBL· GenBank· DDBJ | CAA81928.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006944 EMBL· GenBank· DDBJ | DAA09068.1 EMBL· GenBank· DDBJ | Genomic DNA |