P35370 · OPRX_RAT
- ProteinNociceptin receptor
- GeneOprl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids367 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
G-protein coupled opioid receptor that functions as a receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 107 | Important for G protein-mediated signaling | ||||
Sequence: D | ||||||
Site | 127 | Important for G protein-mediated signaling | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNociceptin receptor
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP35370
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: Ligand binding leads to receptor internalization into cytoplasmic vesicles, decreasing the amount of available receptor at the cell surface (By similarity).
Internalization requires phosphorylation at Ser-360. Can recycle to the cell membrane
Internalization requires phosphorylation at Ser-360. Can recycle to the cell membrane
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-45 | Extracellular | ||||
Sequence: MESLFPAPYWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL | ||||||
Transmembrane | 46-71 | Helical; Name=1 | ||||
Sequence: GLKVTIVGLYLAVCIGGLLGNCLVMY | ||||||
Topological domain | 72-84 | Cytoplasmic | ||||
Sequence: VILRHTKMKTATN | ||||||
Transmembrane | 85-106 | Helical; Name=2 | ||||
Sequence: IYIFNLALADTLVLLTLPFQGT | ||||||
Topological domain | 107-121 | Extracellular | ||||
Sequence: DILLGFWPFGNALCK | ||||||
Transmembrane | 122-143 | Helical; Name=3 | ||||
Sequence: TVIAIDYYNMFTSTFTLTAMSV | ||||||
Topological domain | 144-162 | Cytoplasmic | ||||
Sequence: DRYVAICHPIRALDVRTSS | ||||||
Transmembrane | 163-185 | Helical; Name=4 | ||||
Sequence: KAQAVNVAIWALASVVGVPVAIM | ||||||
Topological domain | 186-208 | Extracellular | ||||
Sequence: GSAQVEDEEIECLVEIPAPQDYW | ||||||
Transmembrane | 209-233 | Helical; Name=5 | ||||
Sequence: GPVFAICIFLFSFIIPVLIISVCYS | ||||||
Topological domain | 234-261 | Cytoplasmic | ||||
Sequence: LMIRRLRGVRLLSGSREKDRNLRRITRL | ||||||
Transmembrane | 262-282 | Helical; Name=6 | ||||
Sequence: VLVVVAVFVGCWTPVQVFVLV | ||||||
Topological domain | 283-297 | Extracellular | ||||
Sequence: QGLGVQPGSETAVAI | ||||||
Transmembrane | 298-319 | Helical; Name=7 | ||||
Sequence: LRFCTALGYVNSCLNPILYAFL | ||||||
Topological domain | 320-367 | Cytoplasmic | ||||
Sequence: DENFKACFRKFCCASSLHREMQVSDRVRSIAKDVGLGCKTSETVPRPA |
Keywords
- Cellular component
Phenotypes & Variants
Chemistry
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000069983 | 1-367 | Nociceptin receptor | |||
Sequence: MESLFPAPYWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASSLHREMQVSDRVRSIAKDVGLGCKTSETVPRPA | ||||||
Glycosylation | 21 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 26 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 36 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 120↔197 | |||||
Sequence: CKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIEC | ||||||
Lipidation | 331 | S-palmitoyl cysteine | ||||
Sequence: C |
Post-translational modification
Phosphorylation at Ser-360 requires GRK3.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in several brain areas, the intestine, liver and spleen. Detected in sympathetic stellate ganglion neurons.
Gene expression databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length367
- Mass (Da)40,523
- Last updated1994-06-01 v1
- ChecksumEB2637582747B4AD
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F7FLX3 | F7FLX3_RAT | Oprl1 | 353 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 105 | in Ref. 2; AAA16201 | ||||
Sequence: G → R | ||||||
Sequence conflict | 226 | in Ref. 2; AAA16201 | ||||
Sequence: L → V | ||||||
Sequence conflict | 246 | in Ref. 2; AAA16201 | ||||
Sequence: S → P | ||||||
Sequence conflict | 348 | in Ref. 3 | ||||
Sequence: S → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D16438 EMBL· GenBank· DDBJ | BAA03908.1 EMBL· GenBank· DDBJ | mRNA | ||
U05239 EMBL· GenBank· DDBJ | AAA16201.1 EMBL· GenBank· DDBJ | mRNA | ||
U01913 EMBL· GenBank· DDBJ | AAA21025.1 EMBL· GenBank· DDBJ | mRNA | ||
L28144 EMBL· GenBank· DDBJ | AAC37661.1 EMBL· GenBank· DDBJ | mRNA | ||
U07871 EMBL· GenBank· DDBJ | AAA69927.1 EMBL· GenBank· DDBJ | mRNA | ||
L33916 EMBL· GenBank· DDBJ | AAA50827.1 EMBL· GenBank· DDBJ | mRNA | ||
L29419 EMBL· GenBank· DDBJ | AAC42041.1 EMBL· GenBank· DDBJ | mRNA | ||
AF216218 EMBL· GenBank· DDBJ | AAF80990.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY152731 EMBL· GenBank· DDBJ | AAN77720.1 EMBL· GenBank· DDBJ | mRNA |