P35283 · RAB12_MOUSE
- ProteinRas-related protein Rab-12
- GeneRab12
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids243 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity).
That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy
That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy
Activity regulation
Rab activation is generally mediated by a guanine exchange factor (GEF), while inactivation through hydrolysis of bound GTP is catalyzed by a GTPase activating protein (GAP) (By similarity).
That Rab is activated by DENND3, a guanine exchange factor
That Rab is activated by DENND3, a guanine exchange factor
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | autophagosome | |
Cellular Component | endosome | |
Cellular Component | Golgi membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | lysosome | |
Cellular Component | phagocytic vesicle | |
Cellular Component | plasma membrane | |
Cellular Component | recycling endosome membrane | |
Cellular Component | secretory granule | |
Cellular Component | synaptic vesicle | |
Cellular Component | trans-Golgi network transport vesicle | |
Molecular Function | GDP binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | autophagy | |
Biological Process | cellular response to type II interferon | |
Biological Process | endocytic recycling | |
Biological Process | endosome to lysosome transport | |
Biological Process | exocytosis | |
Biological Process | positive regulation of macroautophagy | |
Biological Process | protein catabolic process | |
Biological Process | protein secretion | |
Biological Process | Rab protein signal transduction |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rab-12
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP35283
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Recycling endosome membrane ; Lipid-anchor
Lysosome membrane ; Lipid-anchor
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 100 | Probable constitutively active mutant unable to hydrolyze GTP; increases degradation of the transferrin receptor. | ||||
Sequence: Q → L |
PTM/Processing
Features
Showing features for modified residue, chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000121180 | 1-243 | Ras-related protein Rab-12 | |||
Sequence: MDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDVLRNELSNSILSLQPEPEIPPELPPPRPHVRCC | ||||||
Modified residue | 15 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 20 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 24 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 105 | Phosphoserine; by LRRK2 | ||||
Sequence: S | ||||||
Lipidation | 242 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 243 | S-geranylgeranyl cysteine | ||||
Sequence: C |
Post-translational modification
Phosphorylation of Ser-105 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with RABIF and OPTN (PubMed:23357852).
Interacts with LRRK2; interaction facilitates phosphorylation of Ser-105 (By similarity).
Interacts with GDI1, GDI2, CHM and CHML; these interactions are disrupted by phosphorylation on Ser-105 (By similarity).
Interacts with RILPL1 and RILPL2; these interactions are dependent on phosphorylation of Ser-105 (By similarity).
Interacts with LRRK2; interaction facilitates phosphorylation of Ser-105 (By similarity).
Interacts with GDI1, GDI2, CHM and CHML; these interactions are disrupted by phosphorylation on Ser-105 (By similarity).
Interacts with RILPL1 and RILPL2; these interactions are dependent on phosphorylation of Ser-105 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-36 | Disordered | ||||
Sequence: MDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPR | ||||||
Motif | 70-78 | Effector region | ||||
Sequence: CKSTVGVDF |
Sequence similarities
Belongs to the small GTPase superfamily. Rab family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length243
- Mass (Da)27,329
- Last updated2007-01-09 v3
- Checksum34E4EDC67F710510
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A2CG35 | A2CG35_MOUSE | Rab12 | 291 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 83 | in Ref. 3; BAB28956 | ||||
Sequence: V → L | ||||||
Sequence conflict | 86 | in Ref. 3; BAB28956 | ||||
Sequence: R → T | ||||||
Sequence conflict | 184-185 | in Ref. 3; BAB28956 | ||||
Sequence: AS → PD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB232607 EMBL· GenBank· DDBJ | BAF02869.1 EMBL· GenBank· DDBJ | mRNA | ||
M79303 EMBL· GenBank· DDBJ | AAK14827.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013690 EMBL· GenBank· DDBJ | BAB28956.1 EMBL· GenBank· DDBJ | mRNA |