P35212 · CXA4_HUMAN
- ProteinGap junction alpha-4 protein
- GeneGJA4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids333 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | connexin complex | |
Cellular Component | gap junction | |
Cellular Component | plasma membrane | |
Molecular Function | gap junction channel activity | |
Biological Process | blood vessel development | |
Biological Process | calcium ion transport | |
Biological Process | cell-cell junction assembly | |
Biological Process | cell-cell signaling | |
Biological Process | endothelium development | |
Biological Process | response to pain |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGap junction alpha-4 protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP35212
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-20 | Cytoplasmic | ||||
Sequence: MGDWGFLEKLLDQVQEHSTV | ||||||
Transmembrane | 21-40 | Helical | ||||
Sequence: VGKIWLTVLFIFRILILGLA | ||||||
Topological domain | 41-76 | Extracellular | ||||
Sequence: GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIR | ||||||
Transmembrane | 77-99 | Helical | ||||
Sequence: YWVLQFLFVSTPTLVYLGHVIYL | ||||||
Topological domain | 100-148 | Cytoplasmic | ||||
Sequence: SRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIR | ||||||
Transmembrane | 149-165 | Helical | ||||
Sequence: GALMGTYVASVLCKSVL | ||||||
Topological domain | 166-207 | Extracellular | ||||
Sequence: EAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKT | ||||||
Transmembrane | 208-230 | Helical | ||||
Sequence: IFIIFMLVVGLISLVLNLLELVH | ||||||
Topological domain | 231-333 | Cytoplasmic | ||||
Sequence: LLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_009159 | 71 | ||||
Sequence: P → S | ||||||
Natural variant | VAR_009160 | 128 | in dbSNP:rs147128480 | |||
Sequence: A → V | ||||||
Natural variant | VAR_009161 | 130 | in dbSNP:rs41266431 | |||
Sequence: V → I | ||||||
Natural variant | VAR_009162 | 319 | in allele CX37*2; dbSNP:rs1764391 | |||
Sequence: P → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 339 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000057814 | 1-333 | Gap junction alpha-4 protein | |||
Sequence: MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
Gene expression databases
Organism-specific databases
Interaction
Subunit
A connexon is composed of a hexamer of connexins.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P35212 | CD81 P60033 | 3 | EBI-6918707, EBI-712921 | |
BINARY | P35212 | MS4A13 Q5J8X5 | 3 | EBI-6918707, EBI-12070086 | |
BINARY | P35212 | OPRM1 P35372 | 3 | EBI-6918707, EBI-2624570 | |
BINARY | P35212 | Q96FB2 | 3 | EBI-6918707, EBI-2857623 | |
BINARY | P35212 | TMEM86B Q8N661 | 3 | EBI-6918707, EBI-2548832 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 292-333 | Disordered | ||||
Sequence: ANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV |
Sequence similarities
Belongs to the connexin family. Alpha-type (group II) subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length333
- Mass (Da)37,414
- Last updated2007-01-23 v3
- Checksum93AD224531E5EAD2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5JW71 | Q5JW71_HUMAN | GJA4 | 292 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M96789 EMBL· GenBank· DDBJ | AAA52558.2 EMBL· GenBank· DDBJ | mRNA | ||
AF139100 EMBL· GenBank· DDBJ | AAD31869.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF139101 EMBL· GenBank· DDBJ | AAD31870.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF139102 EMBL· GenBank· DDBJ | AAD31871.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF139103 EMBL· GenBank· DDBJ | AAD31872.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF139104 EMBL· GenBank· DDBJ | AAD31873.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF139105 EMBL· GenBank· DDBJ | AAD31874.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF181620 EMBL· GenBank· DDBJ | AAD56940.1 EMBL· GenBank· DDBJ | mRNA | ||
AF132674 EMBL· GenBank· DDBJ | AAF62342.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK291563 EMBL· GenBank· DDBJ | BAF84252.1 EMBL· GenBank· DDBJ | mRNA | ||
AL121988 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471059 EMBL· GenBank· DDBJ | EAX07440.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471059 EMBL· GenBank· DDBJ | EAX07441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC027889 EMBL· GenBank· DDBJ | AAH27889.1 EMBL· GenBank· DDBJ | mRNA | ||
BC072389 EMBL· GenBank· DDBJ | AAH72389.1 EMBL· GenBank· DDBJ | mRNA |