P35001 · NEUM_CHICK
- ProteinNeuromodulin
- GeneGAP43
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids246 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | filopodium membrane | |
Cellular Component | growth cone membrane | |
Cellular Component | neuron projection terminus | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic density | |
Cellular Component | synaptic membrane | |
Molecular Function | calmodulin binding | |
Molecular Function | lysophosphatidic acid binding | |
Molecular Function | phosphatidylinositol phosphate binding | |
Molecular Function | phosphatidylserine binding | |
Biological Process | axon choice point recognition | |
Biological Process | axon regeneration | |
Biological Process | regulation of growth | |
Biological Process | tissue regeneration |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNeuromodulin
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Galliformes > Phasianidae > Phasianinae > Gallus
Accessions
- Primary accessionP35001
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Cell projection, growth cone membrane ; Peripheral membrane protein
Cell projection, filopodium membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000159600 | 1-246 | Neuromodulin | |||
Sequence: MLCCMRRTKQVEKNEDGDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKADAPASESEAADKKDEGPAGGAAENKESEASAATEASAADSAQLDEGSKDSSVPAEEKKGNGAADTGSEQPAPQAATPAASSEEKPAAAAETESATKASTDNSPSLKADEAQDKEEPKQADVPAADTTATTTPAAEDATAKATAQPQMETVESSQTEEKTDAVEETKPTESAQQEEVKEEESKADQENA | ||||||
Lipidation | 3 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 4 | S-palmitoyl cysteine | ||||
Sequence: C |
Post-translational modification
Palmitoylated (PubMed:9813098).
Palmitoylation is essential for plasma membrane association (PubMed:9813098).
Palmitoylation is essential for plasma membrane association (PubMed:9813098).
Keywords
- PTM
Expression
Tissue specificity
Expressed in neurons.
Developmental stage
First expressed in the body and head at embryonic stage 3 dpc (PubMed:2153895).
Expressed in the mid-thoracic region of embryos and also in the spinal cord, dorsal root and sympathetic ganglia at embryonic stage 10 dpc (PubMed:2153895).
Highly expressed in the brain at embryonic stage 13 dpc (PubMed:2153895).
Expressed at low levels in the gut at embryonic stage 16 dpc (PubMed:2153895).
Not expressed in heart, skeletal muscle or liver at embryonic stage 16 dpc (PubMed:2153895).
Expressed in the mid-thoracic region of embryos and also in the spinal cord, dorsal root and sympathetic ganglia at embryonic stage 10 dpc (PubMed:2153895).
Highly expressed in the brain at embryonic stage 13 dpc (PubMed:2153895).
Expressed at low levels in the gut at embryonic stage 16 dpc (PubMed:2153895).
Not expressed in heart, skeletal muscle or liver at embryonic stage 16 dpc (PubMed:2153895).
Interaction
Subunit
Binds calmodulin with a greater affinity in the absence of Ca2+ than in its presence.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-246 | Disordered | ||||
Sequence: MLCCMRRTKQVEKNEDGDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKADAPASESEAADKKDEGPAGGAAENKESEASAATEASAADSAQLDEGSKDSSVPAEEKKGNGAADTGSEQPAPQAATPAASSEEKPAAAAETESATKASTDNSPSLKADEAQDKEEPKQADVPAADTTATTTPAAEDATAKATAQPQMETVESSQTEEKTDAVEETKPTESAQQEEVKEEESKADQENA | ||||||
Compositional bias | 8-37 | Basic and acidic residues | ||||
Sequence: TKQVEKNEDGDQKIEQDGIKPEDKAHKAAT | ||||||
Domain | 32-61 | IQ | ||||
Sequence: AHKAATKIQASFRGHITRKKLKGEKKADAP | ||||||
Compositional bias | 52-79 | Basic and acidic residues | ||||
Sequence: LKGEKKADAPASESEAADKKDEGPAGGA | ||||||
Compositional bias | 164-178 | Basic and acidic residues | ||||
Sequence: KADEAQDKEEPKQAD | ||||||
Compositional bias | 181-210 | Polar residues | ||||
Sequence: AADTTATTTPAAEDATAKATAQPQMETVES | ||||||
Compositional bias | 211-246 | Basic and acidic residues | ||||
Sequence: SQTEEKTDAVEETKPTESAQQEEVKEEESKADQENA |
Sequence similarities
Belongs to the neuromodulin family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length246
- Mass (Da)25,631
- Last updated2022-08-03 v2
- Checksum6F9330F121126F01
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 8-37 | Basic and acidic residues | ||||
Sequence: TKQVEKNEDGDQKIEQDGIKPEDKAHKAAT | ||||||
Compositional bias | 52-79 | Basic and acidic residues | ||||
Sequence: LKGEKKADAPASESEAADKKDEGPAGGA | ||||||
Compositional bias | 164-178 | Basic and acidic residues | ||||
Sequence: KADEAQDKEEPKQAD | ||||||
Compositional bias | 181-210 | Polar residues | ||||
Sequence: AADTTATTTPAAEDATAKATAQPQMETVES | ||||||
Compositional bias | 211-246 | Basic and acidic residues | ||||
Sequence: SQTEEKTDAVEETKPTESAQQEEVKEEESKADQENA |
Keywords
- Technical term