P34969 · 5HT7R_HUMAN
- Protein5-hydroxytryptamine receptor 7
- GeneHTR7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids479 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors (PubMed:35714614, PubMed:8226867).
HTR7 is coupled to G(s) G alpha proteins and mediates activation of adenylate cyclase activity (PubMed:35714614).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | dendrite | |
Cellular Component | plasma membrane | |
Cellular Component | synapse | |
Cellular Component | trans-Golgi network membrane | |
Molecular Function | G protein-coupled serotonin receptor activity | |
Molecular Function | neurotransmitter receptor activity | |
Biological Process | blood circulation | |
Biological Process | chemical synaptic transmission | |
Biological Process | circadian rhythm | |
Biological Process | G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger | |
Biological Process | smooth muscle contraction | |
Biological Process | vasoconstriction |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name5-hydroxytryptamine receptor 7
- Short names5-HT-7 ; 5-HT7
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP34969
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-83 | Extracellular | ||||
Sequence: MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVV | ||||||
Transmembrane | 84-108 | Helical; Name=1 | ||||
Sequence: IGSILTLITLLTIAGNCLVVISVCF | ||||||
Topological domain | 109-118 | Cytoplasmic | ||||
Sequence: VKKLRQPSNY | ||||||
Transmembrane | 119-140 | Helical; Name=2 | ||||
Sequence: LIVSLALADLSVAVAVMPFVSV | ||||||
Topological domain | 141-152 | Extracellular | ||||
Sequence: TDLIGGKWIFGH | ||||||
Transmembrane | 153-178 | Helical; Name=3 | ||||
Sequence: FFCNVFIAMDVMCCTASIMTLCVISI | ||||||
Topological domain | 179-198 | Cytoplasmic | ||||
Sequence: DRYLGITRPLTYPVRQNGKC | ||||||
Transmembrane | 199-219 | Helical; Name=4 | ||||
Sequence: MAKMILSVWLLSASITLPPLF | ||||||
Topological domain | 220-237 | Extracellular | ||||
Sequence: GWAQNVNDDKVCLISQDF | ||||||
Transmembrane | 238-260 | Helical; Name=5 | ||||
Sequence: GYTIYSTAVAFYIPMSVMLFMYY | ||||||
Topological domain | 261-326 | Cytoplasmic | ||||
Sequence: QIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAA | ||||||
Transmembrane | 327-352 | Helical; Name=6 | ||||
Sequence: TTLGIIVGAFTVCWLPFFLLSTARPF | ||||||
Topological domain | 353-363 | Extracellular | ||||
Sequence: ICGTSCSCIPL | ||||||
Transmembrane | 364-387 | Helical; Name=7 | ||||
Sequence: WVERTFLWLGYANSLINPFIYAFF | ||||||
Topological domain | 388-479 | Cytoplasmic | ||||
Sequence: NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_012995 | 92 | in dbSNP:rs1379762209 | |||
Sequence: T → K | ||||||
Mutagenesis | 162 | Abolished G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: D → A | ||||||
Mutagenesis | 166 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: C → A | ||||||
Mutagenesis | 167 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: T → A | ||||||
Mutagenesis | 233 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: I → A | ||||||
Mutagenesis | 240 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: T → A | ||||||
Mutagenesis | 243 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: S → A | ||||||
Natural variant | VAR_012996 | 279 | in dbSNP:rs114969659 | |||
Sequence: P → L | ||||||
Mutagenesis | 340 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: W → A | ||||||
Mutagenesis | 343 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: F → A | ||||||
Mutagenesis | 344 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: F → A | ||||||
Mutagenesis | 374 | Decreased G-protein coupled receptor activity in response to serotonin. | ||||
Sequence: Y → A | ||||||
Natural variant | VAR_049365 | 448 | in dbSNP:rs33954285 | |||
Sequence: P → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 526 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond, modified residue (large scale data), lipidation.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000068979 | 1-479 | UniProt | 5-hydroxytryptamine receptor 7 | |||
Sequence: MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD | |||||||
Glycosylation | 5 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 66 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 155↔231 | UniProt | |||||
Sequence: CNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVC | |||||||
Modified residue (large scale data) | 285 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Lipidation | 401 | UniProt | S-palmitoyl cysteine | ||||
Sequence: C | |||||||
Modified residue (large scale data) | 411 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P34969 | MATR3 P43243 | 2 | EBI-2625020, EBI-352602 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Domain
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Protein family/group databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing. Isoform A and isoform B appear to be expressed at higher levels.
P34969-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameD
- Length479
- Mass (Da)53,555
- Last updated2000-05-30 v2
- Checksum1F62E985EADE1F23
P34969-2
- NameA
- Differences from canonical
- 433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS
P34969-3
- NameB
- Differences from canonical
- 433-479: Missing
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U68487 EMBL· GenBank· DDBJ | AAB48393.1 EMBL· GenBank· DDBJ | mRNA | ||
U68488 EMBL· GenBank· DDBJ | AAB48394.1 EMBL· GenBank· DDBJ | mRNA | ||
U68492 EMBL· GenBank· DDBJ | AAF07218.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U68493 EMBL· GenBank· DDBJ | AAF07217.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U68492 EMBL· GenBank· DDBJ | AAF07217.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U68493 EMBL· GenBank· DDBJ | AAB48397.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
U68492 EMBL· GenBank· DDBJ | AAB48397.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
L21195 EMBL· GenBank· DDBJ | AAC37538.1 EMBL· GenBank· DDBJ | mRNA | ||
AY493988 EMBL· GenBank· DDBJ | AAR87480.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292606 EMBL· GenBank· DDBJ | BAF85295.1 EMBL· GenBank· DDBJ | mRNA | ||
AB451482 EMBL· GenBank· DDBJ | BAG70296.1 EMBL· GenBank· DDBJ | mRNA | ||
AL360011 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471066 EMBL· GenBank· DDBJ | EAW50118.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471066 EMBL· GenBank· DDBJ | EAW50119.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471066 EMBL· GenBank· DDBJ | EAW50120.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC047526 EMBL· GenBank· DDBJ | AAH47526.1 EMBL· GenBank· DDBJ | mRNA |