P34902 · IL2RG_MOUSE
- ProteinCytokine receptor common subunit gamma
- GeneIl2rg
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids369 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Common subunit for the receptors for a variety of interleukins (PubMed:7718508).
Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (By similarity).
Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytokine receptor common subunit gamma
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP34902
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-263 | Extracellular | ||||
Sequence: WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA | ||||||
Transmembrane | 264-284 | Helical | ||||
Sequence: VLIPVGTMGLIITLIFVYCWL | ||||||
Topological domain | 285-369 | Cytoplasmic | ||||
Sequence: ERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MLKLLLSPRSFLVLQLLLLRAG | ||||||
Chain | PRO_0000010867 | 23-369 | Cytokine receptor common subunit gamma | |||
Sequence: WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA | ||||||
Disulfide bond | 62↔72 | |||||
Sequence: CFVFNIEYMNC | ||||||
Glycosylation | 71 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 75 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 84 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 96 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 102↔115 | |||||
Sequence: CSHYLFSKEITSGC | ||||||
Glycosylation | 159 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 164 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 156-254 | Fibronectin type-III | ||||
Sequence: APENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEE | ||||||
Motif | 238-242 | WSXWS motif | ||||
Sequence: WSKWS | ||||||
Motif | 286-294 | Box 1 motif | ||||
Sequence: RMPPIPPIK |
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Sequence similarities
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length369
- Mass (Da)42,241
- Last updated1994-02-01 v1
- ChecksumCB2D5AB459077AC7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B0QZX1 | B0QZX1_MOUSE | Il2rg | 153 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D13821 EMBL· GenBank· DDBJ | BAA02974.1 EMBL· GenBank· DDBJ | mRNA | ||
U21795 EMBL· GenBank· DDBJ | AAA64279.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D13565 EMBL· GenBank· DDBJ | BAA02760.1 EMBL· GenBank· DDBJ | mRNA | ||
L20048 EMBL· GenBank· DDBJ | AAA39286.1 EMBL· GenBank· DDBJ | mRNA | ||
S75852 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75844 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75845 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75847 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75848 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75849 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75850 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S75851 EMBL· GenBank· DDBJ | AAB32904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X75337 EMBL· GenBank· DDBJ | CAA53085.1 EMBL· GenBank· DDBJ | mRNA | ||
BC014720 EMBL· GenBank· DDBJ | AAH14720.1 EMBL· GenBank· DDBJ | mRNA |