P34540 · KINH_CAEEL
- ProteinKinesin heavy chain
- Geneunc-116
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids815 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Microtubule-dependent motor protein required for organelle transport (PubMed:22634595, PubMed:30254025).
Plays a role in endosome transport (PubMed:22634595).
Required for the transport of mitochondria along the axon of motor neurons (PubMed:30254025).
Involved in the nuclear migration of hyp7 hypodermal precursor cells (PubMed:19605495, PubMed:27697906).
Required for the formation of dendritic branches of PVD sensory neurons (PubMed:21205795).
In non-ciliated neurons such as the PVD and PHC neurons, required for the organization of minus-end out microtubules in dendrites (PubMed:30254025).
Also required for the minus-end out orientation of microtubules in dendrites of AQR gas-sensing neurons (PubMed:33460640).
Involved in the localization of unc-33 to neurites (PubMed:16236031).
Positively regulates cilium position and dendrite morphogenesis in the postembryonic AQR and PQR gas-sensing neurons (PubMed:33460640).
Plays a more prominent role in regulating dendrite morphogenesis in AQR than in PQR neurons (PubMed:33460640).
Plays a role in regulating the localization of grdn-1 to the distal dendrites of AQR sensory neurons (PubMed:33460640).
Plays a role in endosome transport (PubMed:22634595).
Required for the transport of mitochondria along the axon of motor neurons (PubMed:30254025).
Involved in the nuclear migration of hyp7 hypodermal precursor cells (PubMed:19605495, PubMed:27697906).
Required for the formation of dendritic branches of PVD sensory neurons (PubMed:21205795).
In non-ciliated neurons such as the PVD and PHC neurons, required for the organization of minus-end out microtubules in dendrites (PubMed:30254025).
Also required for the minus-end out orientation of microtubules in dendrites of AQR gas-sensing neurons (PubMed:33460640).
Involved in the localization of unc-33 to neurites (PubMed:16236031).
Positively regulates cilium position and dendrite morphogenesis in the postembryonic AQR and PQR gas-sensing neurons (PubMed:33460640).
Plays a more prominent role in regulating dendrite morphogenesis in AQR than in PQR neurons (PubMed:33460640).
Plays a role in regulating the localization of grdn-1 to the distal dendrites of AQR sensory neurons (PubMed:33460640).
Features
Showing features for binding site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKinesin heavy chain
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP34540
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Conditional knockout in PVD neuron results in a complete microtubule polarity reversal in the anterior dendrite (PubMed:30254025).
Conditional knockout in motor neuron reduces the number of mitochondria in the axon (PubMed:30254025).
RNAi-mediated knockdown results in reduced dendritic branch formation in PVD sensory neurons (PubMed:21205795).
RNAi-mediated knockdown results in an altered distribution of recycling and late endosomes (PubMed:22634595).
RNAi-mediated knockdown results in defects in nuclear migration in hyp7 hypodermal precursor cells (PubMed:27697906).
RNAi-mediated knockdown in a dhc-1 (js319) mutant background results in defective nuclei migrations in larval hypodermal P-cells (PubMed:27697906).
Conditional knockout in motor neuron reduces the number of mitochondria in the axon (PubMed:30254025).
RNAi-mediated knockdown results in reduced dendritic branch formation in PVD sensory neurons (PubMed:21205795).
RNAi-mediated knockdown results in an altered distribution of recycling and late endosomes (PubMed:22634595).
RNAi-mediated knockdown results in defects in nuclear migration in hyp7 hypodermal precursor cells (PubMed:27697906).
RNAi-mediated knockdown in a dhc-1 (js319) mutant background results in defective nuclei migrations in larval hypodermal P-cells (PubMed:27697906).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000125349 | 1-815 | Kinesin heavy chain | |||
Sequence: MEPRTDGAECGVQVFCRIRPLNKTEEKNADRFLPKFPSEDSISLGGKVYVFDKVFKPNTTQEQVYKGAAYHIVQDVLSGYNGTVFAYGQTSSGKTHTMEGVIGDNGLSGIIPRIVADIFNHIYSMDENLQFHIKVSYYEIYNEKIRDLLDPEKVNLSIHEDKNRVPYVKGATERFVGGPDEVLQAIEDGKSNRMVAVTNMNEHSSRSHSVFLITVKQEHQTTKKQLTGKLYLVDLAGSEKVSKTGAQGTVLEEAKNINKSLTALGIVISALAEGTKSHVPYRDSKLTRILQESLGGNSRTTVIICASPSHFNEAETKSTLLFGARAKTIKNVVQINEELTAEEWKRRYEKEKEKNTRLAALLQAAALELSRWRAGESVSEVEWVNLSDSAQMAVSEVSGGSTPLMERSIAPAPPMLTSTTGPITDEEKKKYEEERVKLYQQLDEKDDEIQKVSQELEKLRQQVLLQEEALGTMRENEELIREENNRFQKEAEDKQQEGKEMMTALEEIAVNLDVRQAECEKLKRELEVVQEDNQSLEDRMNQATSLLNAHLDECGPKIRHFKEGIYNVIREFNIADIASQNDQLPDHDLLNHVRIGVSKLFSEYSAAKESSTAAEHDAEAKLAADVARVESGQDAGRMKQLLVKDQAAKEIKPLTDRVNMELTTLKNLKKEFMRVLVARCQANQDTEGEDSLSGPAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETALRDSKQRSQAERKKYQQEVERIKEAVRQRNMRRMNAPQIVKPIRPGQVYTSPSAGMSQGAPNGSNA |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Oligomer composed of two heavy chains and two light chains.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-329 | Kinesin motor | ||||
Sequence: GVQVFCRIRPLNKTEEKNADRFLPKFPSEDSISLGGKVYVFDKVFKPNTTQEQVYKGAAYHIVQDVLSGYNGTVFAYGQTSSGKTHTMEGVIGDNGLSGIIPRIVADIFNHIYSMDENLQFHIKVSYYEIYNEKIRDLLDPEKVNLSIHEDKNRVPYVKGATERFVGGPDEVLQAIEDGKSNRMVAVTNMNEHSSRSHSVFLITVKQEHQTTKKQLTGKLYLVDLAGSEKVSKTGAQGTVLEEAKNINKSLTALGIVISALAEGTKSHVPYRDSKLTRILQESLGGNSRTTVIICASPSHFNEAETKSTLLFGARAKTI | ||||||
Coiled coil | 335-374 | |||||
Sequence: INEELTAEEWKRRYEKEKEKNTRLAALLQAAALELSRWRA | ||||||
Coiled coil | 422-554 | |||||
Sequence: PITDEEKKKYEEERVKLYQQLDEKDDEIQKVSQELEKLRQQVLLQEEALGTMRENEELIREENNRFQKEAEDKQQEGKEMMTALEEIAVNLDVRQAECEKLKRELEVVQEDNQSLEDRMNQATSLLNAHLDEC | ||||||
Coiled coil | 695-785 | |||||
Sequence: PAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETALRDSKQRSQAERKKYQQEVERIKEAVRQRNMRRMNA | ||||||
Region | 788-815 | Disordered | ||||
Sequence: IVKPIRPGQVYTSPSAGMSQGAPNGSNA | ||||||
Compositional bias | 799-815 | Polar residues | ||||
Sequence: TSPSAGMSQGAPNGSNA |
Domain
Composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it hydrolyzes ATP and binds microtubule), a central alpha-helical coiled coil domain that mediates the heavy chain dimerization; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles.
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length815
- Mass (Da)91,894
- Last updated1995-11-01 v2
- Checksum1B32718C3A7C254C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 799-815 | Polar residues | ||||
Sequence: TSPSAGMSQGAPNGSNA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB017163 EMBL· GenBank· DDBJ | BAA32594.1 EMBL· GenBank· DDBJ | mRNA | ||
L19120 EMBL· GenBank· DDBJ | AAA28155.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | CCD73193.1 EMBL· GenBank· DDBJ | Genomic DNA |