P33895 · NUF2_YEAST
- ProteinKinetochore protein NUF2
- GeneNUF2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids451 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a component of the essential kinetochore-associated NDC80 complex, which is involved in chromosome segregation and spindle checkpoint activity.
Miscellaneous
Present with 1550 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | condensed chromosome, centromeric region | |
Cellular Component | kinetochore | |
Cellular Component | Ndc80 complex | |
Cellular Component | nucleus | |
Cellular Component | outer kinetochore | |
Cellular Component | spindle microtubule | |
Cellular Component | spindle pole body | |
Molecular Function | protein-containing complex binding | |
Biological Process | attachment of mitotic spindle microtubules to kinetochore | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | kinetochore organization | |
Biological Process | meiotic chromosome segregation | |
Biological Process | mitotic spindle organization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKinetochore protein NUF2
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP33895
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with kinetochores.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 338 | Temperature-sensitive. | ||||
Sequence: T → P | ||||||
Mutagenesis | 340 | Temperature-sensitive. | ||||
Sequence: I → K | ||||||
Mutagenesis | 383 | Temperature-sensitive. | ||||
Sequence: Y → C | ||||||
Mutagenesis | 410 | Temperature-sensitive. | ||||
Sequence: L → S | ||||||
Mutagenesis | 441 | Temperature-sensitive. | ||||
Sequence: K → I | ||||||
Mutagenesis | 446 | Temperature-sensitive. | ||||
Sequence: M → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000057995 | 1-451 | Kinetochore protein NUF2 | |||
Sequence: MSRNQDVFPILDLQELVICLQSCDFALATQENISRPTSDYMVTLYKQIIENFMGISVESLLNSSNQETGDGHLQEENENIYLDTLNVLVLNKICFKFFENIGVQDFNMTDLYKPEAQRTQRLLSAVVNYARFREERMFDCNSFILQMESLLGQLRSKFDDYNLIQQQLKQYEDVDGDNIPDEQELQKLEEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESNRDKLIKISNTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFETIISELYDVLRIISSEVQESNRTETELVGLKQNLINNKLKLMNVLETGIMYKLEILQEQLDLQLKNLEKLSQDTKEESRLNDTKLMDLQIKYENEIKPKIDKTDIFIQEELISGKINKLNDEIKQLQKDFEVEVKEIEIEYSLLSGHINKYMNEMLEYMQ |
Proteomic databases
PTM databases
Interaction
Subunit
Component of the NDC80 complex, which consists of TID3/NDC80, NUF2, SPC24 and SPC25. The NDC80 complex is formed by two subcomplexes, TID3/NDC80-NUF2 and SPC24-SPC25, which are joined end-to-end through their coiled-coil domains. It has a rod-like structure with a length of 570 Angstroms and globular domains at either end. The TID3/NDC80-NUF2 globular domains are probably directed to microtubules, the SPC24-SPC25 globular domains to the centromere.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P33895 | CNN1 P43618 | 2 | EBI-12377, EBI-23036 | |
BINARY | P33895 | NDC80 P40460 | 16 | EBI-12377, EBI-25247 | |
BINARY | P33895 | SPC24 Q04477 | 9 | EBI-12377, EBI-27228 | |
BINARY | P33895 | SPC25 P40014 | 6 | EBI-12377, EBI-22458 |
Complex viewer
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 153-291 | |||||
Sequence: QLRSKFDDYNLIQQQLKQYEDVDGDNIPDEQELQKLEEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESNRDKLIKISNTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFE | ||||||
Coiled coil | 341-371 | |||||
Sequence: MYKLEILQEQLDLQLKNLEKLSQDTKEESRL | ||||||
Coiled coil | 398-432 | |||||
Sequence: IQEELISGKINKLNDEIKQLQKDFEVEVKEIEIEY |
Sequence similarities
Belongs to the NUF2 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length451
- Mass (Da)52,973
- Last updated1994-02-01 v1
- ChecksumD58796E1B5D1E772
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 240 | in Ref. 5; AAT92974 | ||||
Sequence: N → Y |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X72225 EMBL· GenBank· DDBJ | CAA51028.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74811 EMBL· GenBank· DDBJ | CAA99079.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY692955 EMBL· GenBank· DDBJ | AAT92974.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA10714.1 EMBL· GenBank· DDBJ | Genomic DNA |