P33314 · BUD2_YEAST
- ProteinInhibitory regulator protein BUD2/CLA2
- GeneBUD2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1104 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Stimulates the GTPase activity of BUD1/RSR1. Participates in the regulation of bud-site selection.
Miscellaneous
Present with 1230 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cellular bud neck | |
Cellular Component | cytoplasm | |
Cellular Component | incipient cellular bud site | |
Cellular Component | prospore membrane | |
Molecular Function | GTPase activator activity | |
Biological Process | axial cellular bud site selection | |
Biological Process | bipolar cellular bud site selection | |
Biological Process | establishment or maintenance of cell polarity | |
Biological Process | filamentous growth | |
Biological Process | invasive filamentous growth | |
Biological Process | invasive growth in response to glucose limitation | |
Biological Process | mitotic spindle orientation checkpoint signaling |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInhibitory regulator protein BUD2/CLA2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP33314
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000056656 | 2-1104 | Inhibitory regulator protein BUD2/CLA2 | |||
Sequence: SSNNEPAQSRTSYFKLNEFLSNVKHYKNTFKGEIQWCNNLSLNDWKTHYLQITSTGALTHSIDELTADSTNIQPIIKHLQQCRIEIIKDKHSSFKDINANCNFIIQVNTSGKDNKVYLRVKSWSDFKKLLTCLIWWSSMKTNGIFNKFQVSRPLEFKSKKMAKPESLLVYKLNVFGPIVKNIVLPPATNILESPDIINNDDNSVGWFSAMGVLKSNGMLDLLLQSDGSLIYSLNISQLLRSEIRILDSSVLQSENSLFLGELPLLRSQLGLEKFRIENIASAATNSSDISQEIIVEFPLRIDLEDCFIALQSFARSEYLSITGSDKSNDMKISNSFKISILEANFQSINLNDKNNTPWSIFTDITAWGHTWARTSMVSNSSNPFWREEFQFNELLRLTNSYLEIKQLFHDLNNKKRLRLIGKIKITQEIINDTRYNKETRLPIMDVDNKNFQIGTICIKISSNLNFILPSTNFVKLEKLLMNANLSMVSNLIYKSSSSMENDNKLTQTSIIFLDIFQSLSRIEEWFHVLIDKELAKIDGTVSRINQKNLDSKHVFNSLFRGNSILTKSIEQYFFRVGNEYLSKALSAILKEIIESNKSCELDPARVKEKDEVKKRKIIADNYKRLYSWVTKIWKRLYATSNDLPIEIRNVLKIFRQKLEIICIDDTLQIILNGISGLLFLRFFCPVILNPKLFKYVSQNLNETARRNLTLISKVLLNLSTLTQFANKEPWLMKMNNFIDKRHNDLLDYIDKMTQKKLDFNSKILNLSSTISRPKLAIEQTMLDDLPQIPYLLDKNLRETEFVNLIVNFSQEDMTKMEKYNHMDNGGKGELIEEEGLLSGSSLNLSVDKKDLDSPIEVKPEIGELEFEKITENNTEIFGDDLMNLLKSDDVGSRSRDLDNGANSGIKFNSIIPKAEEEKHAMKELEQESCLLYNRINHIRKRLSGYECASSTLFEDKKYSISLSHKIFYEEIKEGKEIVLKLLNKPTNENSSARLQKFFTKGVSSKSNNTVGDSYCKFLTIDVSDENPKSSNKTSVHGTSSENGAKDDYLTLPNSQGKGNLGNRFSPTKLSRIMRKPPNADVPKEQNSRKLTRWFKKKKETGGS | ||||||
Modified residue | 854 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 316-444 | C2 | ||||
Sequence: RSEYLSITGSDKSNDMKISNSFKISILEANFQSINLNDKNNTPWSIFTDITAWGHTWARTSMVSNSSNPFWREEFQFNELLRLTNSYLEIKQLFHDLNNKKRLRLIGKIKITQEIINDTRYNKETRLPI | ||||||
Domain | 505-721 | Ras-GAP | ||||
Sequence: KLTQTSIIFLDIFQSLSRIEEWFHVLIDKELAKIDGTVSRINQKNLDSKHVFNSLFRGNSILTKSIEQYFFRVGNEYLSKALSAILKEIIESNKSCELDPARVKEKDEVKKRKIIADNYKRLYSWVTKIWKRLYATSNDLPIEIRNVLKIFRQKLEIICIDDTLQIILNGISGLLFLRFFCPVILNPKLFKYVSQNLNETARRNLTLISKVLLNLST | ||||||
Compositional bias | 1027-1067 | Polar residues | ||||
Sequence: NPKSSNKTSVHGTSSENGAKDDYLTLPNSQGKGNLGNRFSP | ||||||
Region | 1027-1104 | Disordered | ||||
Sequence: NPKSSNKTSVHGTSSENGAKDDYLTLPNSQGKGNLGNRFSPTKLSRIMRKPPNADVPKEQNSRKLTRWFKKKKETGGS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,104
- Mass (Da)126,663
- Last updated1994-06-01 v2
- Checksum451AFC3A78384760
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 437 | in Ref. 1; CAA52228 | ||||
Sequence: N → Y | ||||||
Compositional bias | 1027-1067 | Polar residues | ||||
Sequence: NPKSSNKTSVHGTSSENGAKDDYLTLPNSQGKGNLGNRFSP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X74130 EMBL· GenBank· DDBJ | CAA52228.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L19162 EMBL· GenBank· DDBJ | AAA34461.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X75561 EMBL· GenBank· DDBJ | CAA53241.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z28092 EMBL· GenBank· DDBJ | CAA81930.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006944 EMBL· GenBank· DDBJ | DAA09066.1 EMBL· GenBank· DDBJ | Genomic DNA |