P32833 · ORC2_YEAST
- ProteinOrigin recognition complex subunit 2
- GeneORC2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids620 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the origin recognition complex (ORC) that binds origins of replication. It has a role in both chromosomal replication and mating type transcriptional silencing. Binds to the ARS consensus sequence (ACS) of origins of replication.
Miscellaneous
Present with 1700 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | DNA replication preinitiation complex | |
Cellular Component | nuclear origin of replication recognition complex | |
Cellular Component | nuclear pre-replicative complex | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | chromatin binding | |
Molecular Function | DNA replication origin binding | |
Biological Process | DNA replication initiation | |
Biological Process | pre-replicative complex assembly involved in nuclear cell cycle DNA replication | |
Biological Process | silent mating-type cassette heterochromatin formation | |
Biological Process | subtelomeric heterochromatin formation |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOrigin recognition complex subunit 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP32833
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127082 | 1-620 | Origin recognition complex subunit 2 | |||
Sequence: MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL | ||||||
Modified residue | 60 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 187 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 188 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the origin recognition complex (ORC) composed of at least ORC1, ORC2, ORC3, ORC4, ORC5 and ORC6. Interacts with MCM10 and TAH11.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P32833 | ORC3 P54790 | 7 | EBI-12572, EBI-12576 | |
BINARY | P32833 | ORC5 P50874 | 5 | EBI-12572, EBI-12584 | |
BINARY | P32833 | ORC6 P38826 | 7 | EBI-12572, EBI-12588 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-184 | Disordered | ||||
Sequence: MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNH | ||||||
Compositional bias | 24-45 | Basic and acidic residues | ||||
Sequence: TPKRVDPHGERQLRRIHSSKKN | ||||||
Compositional bias | 80-116 | Basic and acidic residues | ||||
Sequence: RPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNV | ||||||
Compositional bias | 130-146 | Basic and acidic residues | ||||
Sequence: EKTGIKEKREREKIQVA | ||||||
Compositional bias | 147-167 | Polar residues | ||||
Sequence: TTTYEDNVTPQTDDNFVSNSP | ||||||
Region | 204-225 | Disordered | ||||
Sequence: STSPGKLTLSRNFTPTPVPKNK |
Sequence similarities
Belongs to the ORC2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length620
- Mass (Da)71,238
- Last updated1994-02-01 v2
- Checksum486E3E5CE353807F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 24-45 | Basic and acidic residues | ||||
Sequence: TPKRVDPHGERQLRRIHSSKKN | ||||||
Compositional bias | 80-116 | Basic and acidic residues | ||||
Sequence: RPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNV | ||||||
Compositional bias | 130-146 | Basic and acidic residues | ||||
Sequence: EKTGIKEKREREKIQVA | ||||||
Compositional bias | 147-167 | Polar residues | ||||
Sequence: TTTYEDNVTPQTDDNFVSNSP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L23924 EMBL· GenBank· DDBJ | AAA16325.1 EMBL· GenBank· DDBJ | Unassigned DNA | ||
Z21817 EMBL· GenBank· DDBJ | CAA79883.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z35929 EMBL· GenBank· DDBJ | CAA85003.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07180.1 EMBL· GenBank· DDBJ | Genomic DNA |