P32760 · PTN_CHICK
- ProteinPleiotrophin
- GenePTN
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids165 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (By similarity).
Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups (By similarity).
Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration (By similarity).
Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups (By similarity).
Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | chondroitin sulfate binding | |
Molecular Function | growth factor activity | |
Molecular Function | heparin binding | |
Biological Process | bone mineralization | |
Biological Process | brain development | |
Biological Process | cartilage development | |
Biological Process | dermatome development | |
Biological Process | heart development | |
Biological Process | learning | |
Biological Process | limb development | |
Biological Process | neural tube development | |
Biological Process | ossification | |
Biological Process | positive regulation of cell division | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | regulation of endothelial cell migration | |
Biological Process | sclerotome development | |
Biological Process | skin development | |
Biological Process | somitogenesis | |
Biological Process | tendon development |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePleiotrophin
- Short namesPTN
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Galliformes > Phasianidae > Phasianinae > Gallus
Accessions
- Primary accessionP32760
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MPQQQQQRRMFTAALLALVFILAAVSTTEA | ||||||
Chain | PRO_0000164434 | 31-165 | Pleiotrophin | |||
Sequence: GKKEKPEKKAKKSDCGEWQWSVCVPTNGDCGLGTREGTRTGAECKQTTKTQKCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGNLKRALHNADCQKTVTISKPCGKLTKPKPQESKKKKKEGKKQEKMLD | ||||||
Disulfide bond | 45↔74 | |||||
Sequence: CGEWQWSVCVPTNGDCGLGTREGTRTGAEC | ||||||
Disulfide bond | 53↔83 | |||||
Sequence: CVPTNGDCGLGTREGTRTGAECKQTTKTQKC | ||||||
Disulfide bond | 60↔87 | |||||
Sequence: CGLGTREGTRTGAECKQTTKTQKCKIPC | ||||||
Disulfide bond | 97↔129 | |||||
Sequence: CKYQFQAWGECDLNTALKTRTGNLKRALHNADC | ||||||
Disulfide bond | 107↔139 | |||||
Sequence: CDLNTALKTRTGNLKRALHNADCQKTVTISKPC |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 90-97 | Chondroitin sulfate binding | ||||
Sequence: KKQFGAEC | ||||||
Region | 121-129 | Chondroitin sulfate binding | ||||
Sequence: KRALHNADC | ||||||
Region | 137-165 | Disordered | ||||
Sequence: KPCGKLTKPKPQESKKKKKEGKKQEKMLD | ||||||
Compositional bias | 144-165 | Basic and acidic residues | ||||
Sequence: KPKPQESKKKKKEGKKQEKMLD | ||||||
Region | 145-165 | Chondroitin sulfate A binding | ||||
Sequence: PKPQESKKKKKEGKKQEKMLD |
Sequence similarities
Belongs to the pleiotrophin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length165
- Mass (Da)18,513
- Last updated2019-05-08 v2
- Checksum19F6518E0DE6F1CE
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8V0YTR5 | A0A8V0YTR5_CHICK | PTN | 161 | ||
A0A8V0YTS0 | A0A8V0YTS0_CHICK | PTN | 177 | ||
A0A8V0YNQ0 | A0A8V0YNQ0_CHICK | PTN | 162 | ||
A0A8V0YNQ5 | A0A8V0YNQ5_CHICK | PTN | 189 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 144-165 | Basic and acidic residues | ||||
Sequence: KPKPQESKKKKKEGKKQEKMLD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AADN04000025 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |