P32652 · POLG_MDMV
- ProteinGenome polyprotein
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids380 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Nuclear inclusion protein B
An RNA-dependent RNA polymerase that plays an essential role in the virus replication.
Capsid protein
Involved in aphid transmission, cell-to-cell and systemis movement, encapsidation of the viral RNA and in the regulation of viral RNA amplification.
Catalytic activity
- a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 52-53 | Cleavage; by NIa-pro | ||||
Sequence: QS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | viral capsid | |
Molecular Function | RNA-dependent RNA polymerase activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameGenome polyprotein
- Cleaved into 2 chains
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Stelpaviricetes > Patatavirales > Potyviridae > Potyvirus
- Virus hosts
Accessions
- Primary accessionP32652
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000040289 | 1-52 | Nuclear inclusion protein B | |||
Sequence: KEGLAPYIAETALRNLYLGTGIKEEEIEKYLKQFIKDLPGYIEDYNEDVFHQ | ||||||
Chain | PRO_0000420001 | 1-380 | Genome polyprotein | |||
Sequence: KEGLAPYIAETALRNLYLGTGIKEEEIEKYLKQFIKDLPGYIEDYNEDVFHQSGTVDAGAQGGSGSQGTTPPATGSGAKPATSGAGSGSGTGAGTGVTGGQARTGSGTGTGSGATGGQSGSGSGTEQVNTGSAGTNATGGQRDRDVDAGSTGKISVPKLKAMSKKMRLPKAKAKDVLHLDFLLTYKPQQQDISNTRATKEEFDRWYDAYKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINGNWTMMDKDEQRVFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNISDYSLARYAFDFYEMTSRTPARAKEAHMQMKAAAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMHSLLGVQQHH | ||||||
Chain | PRO_0000040290 | 53-380 | Capsid protein | |||
Sequence: SGTVDAGAQGGSGSQGTTPPATGSGAKPATSGAGSGSGTGAGTGVTGGQARTGSGTGTGSGATGGQSGSGSGTEQVNTGSAGTNATGGQRDRDVDAGSTGKISVPKLKAMSKKMRLPKAKAKDVLHLDFLLTYKPQQQDISNTRATKEEFDRWYDAYKKEYEIDDTQMTVVMSGLMVWCIENGCSPNINGNWTMMDKDEQRVFPLKPVIENASPTFRQIMHHFSDAAEAYIEYRNSTERYMPRYGLQRNISDYSLARYAFDFYEMTSRTPARAKEAHMQMKAAAVRGSNTRLFGLDGNVGETQENTERHTAGDVSRNMHSLLGVQQHH |
Post-translational modification
Genome polyprotein of potyviruses undergoes post-translational proteolytic processing by the main proteinase NIa-pro resulting in the production of at least ten individual proteins. The P1 proteinase and the HC-pro cleave only their respective C-termini autocatalytically. 6K1 is essential for proper proteolytic separation of P3 from CI (By similarity).
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 54-154 | Disordered | ||||
Sequence: GTVDAGAQGGSGSQGTTPPATGSGAKPATSGAGSGSGTGAGTGVTGGQARTGSGTGTGSGATGGQSGSGSGTEQVNTGSAGTNATGGQRDRDVDAGSTGKI | ||||||
Compositional bias | 57-139 | Polar residues | ||||
Sequence: DAGAQGGSGSQGTTPPATGSGAKPATSGAGSGSGTGAGTGVTGGQARTGSGTGTGSGATGGQSGSGSGTEQVNTGSAGTNATG | ||||||
Region | 349-380 | Disordered | ||||
Sequence: GNVGETQENTERHTAGDVSRNMHSLLGVQQHH |
Sequence similarities
Belongs to the potyviridae genome polyprotein family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length380
- Mass (Da)41,120
- Last updated1993-10-01 v1
- ChecksumB8ABF2AA45E1CB82
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: K | ||||||
Compositional bias | 57-139 | Polar residues | ||||
Sequence: DAGAQGGSGSQGTTPPATGSGAKPATSGAGSGSGTGAGTGVTGGQARTGSGTGTGSGATGGQSGSGSGTEQVNTGSAGTNATG |