P32321 · DCTD_HUMAN
- ProteinDeoxycytidylate deaminase
- GeneDCTD
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids178 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the deamination of dCMP to dUMP, providing the nucleoside monophosphate substrate for the thymidylate synthase/TYMS (PubMed:7685356).
Also, part of a nucleotide salvage pathway that eliminates epigenetically modified 5-hydroxymethyl-dCMP (hmdCMP) in a two-step process entailing deamination to cytotoxic 5-hydroxymethyl-dUMP (hmdUMP), followed by its hydrolysis into 5-hydroxymethyluracil (hmU) and 2-deoxy-D-ribose 5-phosphate (deoxyribosephosphate) (PubMed:33833118).
Catalyzes the first step in that pathway, the deamination of 5-hydroxymethyl-dCMP (hmdCMP) (PubMed:33833118).
Also, part of a nucleotide salvage pathway that eliminates epigenetically modified 5-hydroxymethyl-dCMP (hmdCMP) in a two-step process entailing deamination to cytotoxic 5-hydroxymethyl-dUMP (hmdUMP), followed by its hydrolysis into 5-hydroxymethyluracil (hmU) and 2-deoxy-D-ribose 5-phosphate (deoxyribosephosphate) (PubMed:33833118).
Catalyzes the first step in that pathway, the deamination of 5-hydroxymethyl-dCMP (hmdCMP) (PubMed:33833118).
Catalytic activity
- dCMP + H+ + H2O = dUMP + NH4+This reaction proceeds in the forward direction.
- 5-hydroxymethyl-dCMP + H+ + H2O = 5-hydroxymethyl-dUMP + NH4+This reaction proceeds in the forward direction.
Cofactor
Activity regulation
Allosteric enzyme whose activity is greatly influenced by the end products of its metabolic pathway, dCTP and dTTP.
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Molecular Function | dCMP deaminase activity | |
Molecular Function | deoxyribonucleoside 5'-monophosphate N-glycosidase activity | |
Molecular Function | identical protein binding | |
Molecular Function | zinc ion binding | |
Biological Process | cytidine deamination | |
Biological Process | nucleoside salvage | |
Biological Process | nucleotide biosynthetic process | |
Biological Process | pyrimidine nucleotide metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDeoxycytidylate deaminase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP32321
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 239 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000171691 | 1-178 | Deoxycytidylate deaminase | |||
Sequence: MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ | ||||||
Modified residue | 174 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Homohexamer.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P32321 | ACOT7 O00154-4 | 3 | EBI-739870, EBI-12007918 | |
BINARY | P32321 | DCTD P32321 | 5 | EBI-739870, EBI-739870 | |
BINARY | P32321 | FGF12 P61328 | 3 | EBI-739870, EBI-6657662 | |
BINARY | P32321 | GORASP2 Q9H8Y8 | 7 | EBI-739870, EBI-739467 | |
BINARY | P32321 | MALSU1 Q96EH3 | 6 | EBI-739870, EBI-2339737 | |
BINARY | P32321 | PICK1 Q9NRD5 | 3 | EBI-739870, EBI-79165 | |
BINARY | P32321 | PSMA1 P25786 | 3 | EBI-739870, EBI-359352 | |
BINARY | P32321 | SDCBP O00560 | 6 | EBI-739870, EBI-727004 | |
BINARY | P32321 | TXN2 Q99757 | 3 | EBI-739870, EBI-2932492 | |
BINARY | P32321 | UBE2I Q7KZS0 | 3 | EBI-739870, EBI-10180829 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 14-145 | CMP/dCMP-type deaminase | ||||
Sequence: EWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLF |
Sequence similarities
Belongs to the cytidine and deoxycytidylate deaminase family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P32321-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length178
- Mass (Da)20,016
- Last updated2002-09-19 v2
- Checksum2B8DA5EAC85F3666
P32321-2
- Name2
- Differences from canonical
- 1-1: M → MVGGGQPCGPNM
Computationally mapped potential isoform sequences
There are 10 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_038094 | 1 | in isoform 2 | |||
Sequence: M → MVGGGQPCGPNM | ||||||
Sequence conflict | 95 | in Ref. 6; AAH01286 | ||||
Sequence: S → L | ||||||
Sequence conflict | 128 | in Ref. 1; AAA35755 | ||||
Sequence: M → T |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L12136 EMBL· GenBank· DDBJ | AAA35755.1 EMBL· GenBank· DDBJ | mRNA | ||
L39874 EMBL· GenBank· DDBJ | AAC37579.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK313221 EMBL· GenBank· DDBJ | BAG36033.1 EMBL· GenBank· DDBJ | mRNA | ||
AC079766 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471056 EMBL· GenBank· DDBJ | EAX04697.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471056 EMBL· GenBank· DDBJ | EAX04698.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471056 EMBL· GenBank· DDBJ | EAX04700.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471056 EMBL· GenBank· DDBJ | EAX04701.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001286 EMBL· GenBank· DDBJ | AAH01286.1 EMBL· GenBank· DDBJ | mRNA | ||
BC088357 EMBL· GenBank· DDBJ | AAH88357.2 EMBL· GenBank· DDBJ | mRNA |