P32144 · CSQR_ECOLI
- ProteinHTH-type transcriptional repressor CsqR
- GenecsqR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids261 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Involved in the regulation of the sulfoquinovose operon (PubMed:24463506, PubMed:30372406).
Represses the expression of the yihUTS operon and of the yihV and csqR genes. Binds DNA inside the spacer between the bidirectional transcription units comprising the yihUTS operon and the yihV gene, and upstream the csqR gene itself (PubMed:30372406).
Represses the expression of the yihUTS operon and of the yihV and csqR genes. Binds DNA inside the spacer between the bidirectional transcription units comprising the yihUTS operon and the yihV gene, and upstream the csqR gene itself (PubMed:30372406).
Activity regulation
Inactivated in the presence of the effectors sulfoquinovose and sulfoquinovosyl glycerol, leading to the de-repression of the target genes.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 25-44 | H-T-H motif | ||||
Sequence: MNIDELANLLDVSTQTVRRD |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | negative regulation of DNA-templated transcription initiation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHTH-type transcriptional repressor CsqR
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP32144
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000050276 | 1-261 | HTH-type transcriptional repressor CsqR | |||
Sequence: MSLTELTGNPRHDQLLMLIAERGYMNIDELANLLDVSTQTVRRDIRKLSEQGLITRHHGGAGRASSVVNTAFEQREVSQTEEKKAIAEAVADYIPDGSTIFITIGTTVEHVARALLNHNHLRIITNSLRVAHILYHNPRFEVMVPGGTLRSHNSGIIGPSAASFVADFRADYLVTSVGAIESDGALMEFDVNEANVVKTMMAHARNILLVADHTKYHASAAVEIGNVAQVTALFTDELPPAALKSRLQDSQIEIILPQEDA |
Proteomic databases
Expression
Induction
Negatively autoregulated.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-63 | HTH deoR-type | ||||
Sequence: GNPRHDQLLMLIAERGYMNIDELANLLDVSTQTVRRDIRKLSEQGLITRHHGGAGR |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length261
- Mass (Da)28,507
- Last updated2001-04-27 v2
- ChecksumA529920D22C9DD19
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L19201 EMBL· GenBank· DDBJ | AAB03017.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
U00096 EMBL· GenBank· DDBJ | AAD13446.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE77425.1 EMBL· GenBank· DDBJ | Genomic DNA |