P31582 · RAF2A_ARATH
- ProteinRas-related protein RABF2a
- GeneRABF2A
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids200 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the trafficking of soluble cargo proteins from the prevacuolar compartment to the central vacuole (PubMed:12724533, PubMed:21899678).
Involved in vacuolar transport of storage proteins with EREX as effector. Regulates membrane trafficking to protein storage vacuoles (PSVs)
Involved in vacuolar transport of storage proteins with EREX as effector. Regulates membrane trafficking to protein storage vacuoles (PSVs)
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endosome membrane | |
Cellular Component | vacuolar membrane | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | protein transport | |
Biological Process | vacuolar transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameRas-related protein RABF2a
- Short namesAtRABF2a
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP31582
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Endosome membrane ; Lipid-anchor
Prevacuolar compartment membrane ; Lipid-anchor
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 24 | Dominant negative (GDP-bound form); loss of targeting to the prevacuolar compartment. Inhibits vacuolar trafficking. No effect on the interaction with VPS9A. Loss of interaction with EREX. | ||||
Sequence: S → N | ||||||
Mutagenesis | 42 | Loss of targeting to the prevacuolar compartment, but no effect on the vacuolar trafficking. | ||||
Sequence: T → A | ||||||
Mutagenesis | 69 | Constitutively active (GTP-bound form); no effect on the targeting to the prevacuolar compartment. Loss of interaction with VPS9A. | ||||
Sequence: Q → L | ||||||
Mutagenesis | 123 | Blocks nucleotide binding; no effect on the interaction with VPS9A. | ||||
Sequence: N → I | ||||||
Mutagenesis | 198-199 | Loss of targeting to the prevacuolar compartment, but no effect on the vacuolar trafficking. | ||||
Sequence: CC → SS |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000121277 | 1-200 | Ras-related protein RABF2a | |||
Sequence: MASSGNKNINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDITNQASFERAKKWVQELQAQGNPNMVMALAGNKADLLDARKVSAEEAEIYAQENSLFFMETSAKTATNVKDIFYEIAKRLPRVQPAENPTGMVLPNGPGATAVSSSCCA | ||||||
Lipidation | 198 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 199 | S-geranylgeranyl cysteine | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
High in stem, root, and inflorescence.
Induction
Activated by VPS9A.
Developmental stage
Expressed during pollen germination and pollen tube growth.
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 39-47 | Effector region | ||||
Sequence: QESTIGAAF |
Sequence similarities
Belongs to the small GTPase superfamily. Rab family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length200
- Mass (Da)21,654
- Last updated1993-07-01 v1
- Checksum98E2ED559A59DE35
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BA31 | A0A1P8BA31_ARATH | RHA1 | 208 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X59152 EMBL· GenBank· DDBJ | CAA41863.1 EMBL· GenBank· DDBJ | mRNA | ||
Z22958 EMBL· GenBank· DDBJ | CAA80534.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB019224 EMBL· GenBank· DDBJ | BAB09498.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED95208.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF389298 EMBL· GenBank· DDBJ | AAK63870.1 EMBL· GenBank· DDBJ | mRNA | ||
AY097362 EMBL· GenBank· DDBJ | AAM19878.1 EMBL· GenBank· DDBJ | mRNA |