P31362 · PO2F3_MOUSE
- ProteinPOU domain, class 2, transcription factor 3
- GenePou2f3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids431 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') (PubMed:8441607).
Regulates cell type-specific differentiation pathways. Involved in the regulation of keratinocytes differentiation (PubMed:9242494).
The POU2F3-POU2AF2/POU2AF3 complex drives the expression of tuft-cell-specific genes, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues (By similarity).
Regulates cell type-specific differentiation pathways. Involved in the regulation of keratinocytes differentiation (PubMed:9242494).
The POU2F3-POU2AF2/POU2AF3 complex drives the expression of tuft-cell-specific genes, a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues (By similarity).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 274-333 | Homeobox | ||||
Sequence: KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRIN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nuclear body | |
Cellular Component | nucleolus | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | identical protein binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | cell differentiation | |
Biological Process | epidermis development | |
Biological Process | keratinocyte differentiation | |
Biological Process | negative regulation by host of viral transcription | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | wound healing |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePOU domain, class 2, transcription factor 3
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP31362
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Mice homozygous for null mutation exhibit defective keratinocyte differentiation, however the skin and coat appear normal.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 24 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000100718 | 1-431 | POU domain, class 2, transcription factor 3 | |||
Sequence: MVNLEPMHTEIKMSGDVADSTDTRSTFGQVEPGNDRNGLDFNRQIKTEDLGDSLQQTLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLASQAVGRPGLSGSSLEPHLDAPQHLPGPKHLPGPGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSGSWYRWNHPTYLH |
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-39 | Disordered | ||||
Sequence: MVNLEPMHTEIKMSGDVADSTDTRSTFGQVEPGNDRNGL | ||||||
Compositional bias | 16-32 | Polar residues | ||||
Sequence: DVADSTDTRSTFGQVEP | ||||||
Region | 130-180 | Disordered | ||||
Sequence: LLPQTGPGLASQAVGRPGLSGSSLEPHLDAPQHLPGPKHLPGPGGNDEPTD | ||||||
Domain | 176-250 | POU-specific | ||||
Sequence: DEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE | ||||||
Region | 248-267 | Disordered | ||||
Sequence: DAESSPSDPSASTPSSYPTL | ||||||
Compositional bias | 250-267 | Polar residues | ||||
Sequence: ESSPSDPSASTPSSYPTL | ||||||
Region | 352-419 | Disordered | ||||
Sequence: PSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSG | ||||||
Compositional bias | 366-419 | Polar residues | ||||
Sequence: STMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSG |
Sequence similarities
Belongs to the POU transcription factor family. Class-2 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length431
- Mass (Da)46,960
- Last updated2022-12-14 v3
- ChecksumEE43C0C4E8D380F2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3U5D1 | Q3U5D1_MOUSE | Pou2f3 | 419 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 16-32 | Polar residues | ||||
Sequence: DVADSTDTRSTFGQVEP | ||||||
Sequence conflict | 139 | in Ref. 2; AAA16855 | ||||
Sequence: A → R | ||||||
Sequence conflict | 249 | in Ref. 2; AAA16855 | ||||
Sequence: A → P | ||||||
Compositional bias | 250-267 | Polar residues | ||||
Sequence: ESSPSDPSASTPSSYPTL | ||||||
Compositional bias | 366-419 | Polar residues | ||||
Sequence: STMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNSSSSSSFNSSG | ||||||
Sequence conflict | 396-431 | in Ref. 1; CAA79222 | ||||
Sequence: PTASQNNSKAAMNSSSSSSFNSSGSWYRWNHPTYLH → SQVWALLT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z18537 EMBL· GenBank· DDBJ | CAA79222.1 EMBL· GenBank· DDBJ | mRNA | ||
L14677 EMBL· GenBank· DDBJ | AAA16855.1 EMBL· GenBank· DDBJ | mRNA | ||
AC173346 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |