P31266 · SUH_MOUSE
- ProteinRecombining binding protein suppressor of hairless
- GeneRbpj
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids526 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations (PubMed:7566092).
Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes (By similarity) (PubMed:18381292).
Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (By similarity).
Negatively regulates the phagocyte oxidative burst in response to bacterial infection by repressing transcription of NADPH oxidase subunits (PubMed:26194095).
Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes (By similarity) (PubMed:18381292).
Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (By similarity).
Negatively regulates the phagocyte oxidative burst in response to bacterial infection by repressing transcription of NADPH oxidase subunits (PubMed:26194095).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRecombining binding protein suppressor of hairless
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP31266
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 128 | No effect on interaction with L3MBTL3. | ||||
Sequence: F → R | ||||||
Mutagenesis | 172 | No effect on interaction with L3MBTL3. | ||||
Sequence: F → R | ||||||
Mutagenesis | 186 | No effect on interaction with L3MBTL3. | ||||
Sequence: R → E | ||||||
Mutagenesis | 261 | Loss of interaction with L3MBTL3. | ||||
Sequence: F → R | ||||||
Mutagenesis | 263 | Decreased interaction with L3MBTL3. | ||||
Sequence: V → R | ||||||
Mutagenesis | 284 | Decreased interaction with L3MBTL3. | ||||
Sequence: A → R | ||||||
Mutagenesis | 333 | No effect on interaction with L3MBTL3. | ||||
Sequence: Q → R | ||||||
Mutagenesis | 389 | No effect on interaction with L3MBTL3. | ||||
Sequence: N → R | ||||||
Mutagenesis | 398 | No effect on interaction with L3MBTL3. | ||||
Sequence: E → R | ||||||
Mutagenesis | 407 | No effect on interaction with L3MBTL3. | ||||
Sequence: N → R | ||||||
Mutagenesis | 422 | No effect on interaction with L3MBTL3. | ||||
Sequence: R → E | ||||||
Mutagenesis | 425 | No effect on interaction with L3MBTL3. | ||||
Sequence: E → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 20 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000208568 | 1-526 | Recombining binding protein suppressor of hairless | |||
Sequence: MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS | ||||||
Modified residue | 201 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with RITA1, leading to nuclear export, prevent the interaction between RBPJ and NICD product and subsequent down-regulation of the Notch signaling pathway (By similarity).
Interacts with activated NOTCH1, NOTCH2 and NOTCH3. Interacts with MINT/SHARP. This interaction may mediate the recruitment of large corepressor complexes containing proteins such as HDAC1, HDAC2, NCOR2, SAP30, FHL1/KYOT2 and CIR1. Interacts with EP300, MAML1 and PTF1A. Interacts with SNW1. Interacts with CHCHD2 and CXXC5. Interacts with BEND6 (via BEN domain) (By similarity).
Interacts with NKAPL (PubMed:25875095).
Interacts with ZMIZ1 (By similarity).
Interacts with RBM15 (PubMed:17283045).
Interacts with L3MBTL3; the interaction is impaired by Notch-derived peptides containing the intracellular domain (NICD) (PubMed:29030483).
Interacts with KDM1A; the interaction with KDM1A is weaker in the absence of L3MBTL3 (By similarity).
Interacts with activated NOTCH1, NOTCH2 and NOTCH3. Interacts with MINT/SHARP. This interaction may mediate the recruitment of large corepressor complexes containing proteins such as HDAC1, HDAC2, NCOR2, SAP30, FHL1/KYOT2 and CIR1. Interacts with EP300, MAML1 and PTF1A. Interacts with SNW1. Interacts with CHCHD2 and CXXC5. Interacts with BEND6 (via BEN domain) (By similarity).
Interacts with NKAPL (PubMed:25875095).
Interacts with ZMIZ1 (By similarity).
Interacts with RBM15 (PubMed:17283045).
Interacts with L3MBTL3; the interaction is impaired by Notch-derived peptides containing the intracellular domain (NICD) (PubMed:29030483).
Interacts with KDM1A; the interaction with KDM1A is weaker in the absence of L3MBTL3 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P31266 | Fhl1 P97447-2 | 4 | EBI-1392666, EBI-16082627 | |
BINARY | P31266 | Notch1 Q01705 | 8 | EBI-1392666, EBI-1392707 | |
BINARY | P31266 | Smarcd3 Q6P9Z1 | 3 | EBI-1392666, EBI-7525857 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-57 | Disordered | ||||
Sequence: MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAGKFGERPPPKRL | ||||||
Region | 83-93 | DNA-binding | ||||
Sequence: QKSYGNEKRFF | ||||||
Region | 191-196 | DNA-binding | ||||
Sequence: SKPSKK | ||||||
Region | 218-223 | DNA-binding | ||||
Sequence: RLRSQT | ||||||
Domain | 381-471 | IPT/TIG | ||||
Sequence: PVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYT | ||||||
Region | 491-526 | Disordered | ||||
Sequence: SSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS |
Sequence similarities
Belongs to the Su(H) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P31266-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length526
- Mass (Da)58,537
- Last updated1993-07-01 v1
- Checksum8BF517CC24099E03
P31266-2
- Name2
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0J9YVE0 | A0A0J9YVE0_MOUSE | Rbpj | 180 | ||
Q3U6F1 | Q3U6F1_MOUSE | Rbpj | 465 | ||
E9Q7W0 | E9Q7W0_MOUSE | Rbpj | 485 | ||
A0A0J9YTV5 | A0A0J9YTV5_MOUSE | Rbpj | 507 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S63463 EMBL· GenBank· DDBJ | AAB20195.1 EMBL· GenBank· DDBJ | mRNA | ||
X17459 EMBL· GenBank· DDBJ | CAA35501.1 EMBL· GenBank· DDBJ | mRNA | ||
X58337 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
M81867 EMBL· GenBank· DDBJ | AAA39018.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81865 EMBL· GenBank· DDBJ | AAA39018.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81866 EMBL· GenBank· DDBJ | AAA39018.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81868 EMBL· GenBank· DDBJ | AAA39019.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81870 EMBL· GenBank· DDBJ | AAA39020.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
M81869 EMBL· GenBank· DDBJ | AAA39020.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
M81873 EMBL· GenBank· DDBJ | AAA39021.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81872 EMBL· GenBank· DDBJ | AAA39021.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81875 EMBL· GenBank· DDBJ | AAA39022.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81874 EMBL· GenBank· DDBJ | AAA39022.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81876 EMBL· GenBank· DDBJ | AAA39023.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M81877 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC051387 EMBL· GenBank· DDBJ | AAH51387.1 EMBL· GenBank· DDBJ | mRNA | ||
AK080359 EMBL· GenBank· DDBJ | BAC37889.1 EMBL· GenBank· DDBJ | mRNA |