P31240 · PDGFB_MOUSE
- ProteinPlatelet-derived growth factor subunit B
- GenePdgfb
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids241 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 108 | Involved in receptor binding | ||||
Sequence: R | ||||||
Site | 111 | Involved in receptor binding | ||||
Sequence: I |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePlatelet-derived growth factor subunit B
- Short namesPDGF subunit B
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP31240
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Released by platelets upon wounding.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Perinatal lethality, due to severe hemorrhages shortly before birth. Kidney glomerular tufts do not form, apparently because of absence of mesangial cells. The heart and some large arteries are dilated in late-stage embryos. Mice lack microvascular pericytes, which normally form part of the capillary wall, and develop numerous capillary microaneurysms, leading to hemorrhages. Mice display erythroblastosis, macrocytic anemia, and thrombocytopenia.
Keywords
- Disease
PTM/Processing
Features
Showing features for signal, propeptide, glycosylation, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MNRCWALFLPLCCYLRLVSA | ||||||
Propeptide | PRO_0000023374 | 21-81 | Removed in mature form | |||
Sequence: EGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRR | ||||||
Glycosylation | 63 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Chain | PRO_0000023375 | 82-190 | Platelet-derived growth factor subunit B | |||
Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT | ||||||
Disulfide bond | 97↔141 | |||||
Sequence: CKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQC | ||||||
Disulfide bond | 124 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 130↔178 | |||||
Sequence: CSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLAC | ||||||
Disulfide bond | 133 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 134↔180 | |||||
Sequence: CNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC | ||||||
Propeptide | PRO_0000023376 | 191-241 | Removed in mature form | |||
Sequence: RSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLGA |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Localized to vascular smooth muscle cells. Also weakly expressed by cortical interstitial cells but absent in tubules. Up-regulated in areas of renal fibrosis. In mice with unilateral ureteral obstruction, an increased expression in interstitial cells and in some tubules observed after day 4.
Interaction
Subunit
Antiparallel homodimer; disulfide-linked. Antiparallel heterodimer with PDGFA; disulfide-linked. The PDGFB homodimer interacts with PDGFRA and PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. The heterodimer composed of PDGFA and PDGFB interacts with PDGFRB homodimers, and with heterodimers formed by PDGFRA and PDGFRB. Interacts with XLKD1 (By similarity).
Interacts with LRP1. Interacts with SORL1 (via the N-terminal ectodomain). Interacts with CD82; this interaction inhibits PDGFB-mediated signaling pathway (By similarity).
Interacts with LRP1. Interacts with SORL1 (via the N-terminal ectodomain). Interacts with CD82; this interaction inhibits PDGFB-mediated signaling pathway (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 217-241 | Disordered | ||||
Sequence: RPPKGKHRKFKHTHDKAALKETLGA |
Sequence similarities
Belongs to the PDGF/VEGF growth factor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length241
- Mass (Da)27,382
- Last updated1993-07-01 v1
- Checksum3C5EB7A2DAD64178
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0R4IZW4 | A0A0R4IZW4_MOUSE | Pdgfb | 241 | ||
A0A2R8VHJ1 | A0A2R8VHJ1_MOUSE | Pdgfb | 169 | ||
A0A2R8W6F2 | A0A2R8W6F2_MOUSE | Pdgfb | 49 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 183 | in Ref. 2; AAH53430/AAH64056 | ||||
Sequence: I → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M84453 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M84448 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M84449 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M84450 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M84451 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M84452 EMBL· GenBank· DDBJ | AAA40113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64849 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64844 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64845 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64846 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64847 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64848 EMBL· GenBank· DDBJ | AAA37485.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC053430 EMBL· GenBank· DDBJ | AAH53430.1 EMBL· GenBank· DDBJ | mRNA | ||
BC064056 EMBL· GenBank· DDBJ | AAH64056.1 EMBL· GenBank· DDBJ | mRNA |