P31169 · KIN2_ARATH
- ProteinStress-induced protein KIN2
- GeneKIN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | plastid | |
Molecular Function | mRNA binding | |
Biological Process | response to abscisic acid | |
Biological Process | response to osmotic stress | |
Biological Process | response to water deprivation |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameStress-induced protein KIN2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP31169
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000155162 | 1-66 | Stress-induced protein KIN2 | |||
Sequence: MSETNKNAFQAGQAAGKAEEKSNVLLDKAKDAAAAAGASAQQAGKSISDAAVGGVNFVKDKTGLNK |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at high levels in embryos and mature seeds.
Induction
By cold stress, abscisic acid (ABA) and water stress.
Gene expression databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length66
- Mass (Da)6,551
- Last updated1993-07-01 v1
- Checksum3DDFBA633C8E0DE5
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X55053 EMBL· GenBank· DDBJ | CAA38894.1 EMBL· GenBank· DDBJ | mRNA | ||
X62281 EMBL· GenBank· DDBJ | CAA44171.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL391145 EMBL· GenBank· DDBJ | CAC01796.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED92231.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY072302 EMBL· GenBank· DDBJ | AAL61909.1 EMBL· GenBank· DDBJ | mRNA | ||
AY114545 EMBL· GenBank· DDBJ | AAM47864.1 EMBL· GenBank· DDBJ | mRNA |