P30677 · GNA14_MOUSE
- ProteinGuanine nucleotide-binding protein subunit alpha-14
- GeneGna14
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids355 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 42-49 | GTP (UniProtKB | ChEBI) | ||||
Sequence: GTGESGKS | ||||||
Binding site | 49 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 176-182 | GTP (UniProtKB | ChEBI) | ||||
Sequence: LRVRVPT | ||||||
Binding site | 182 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 201-205 | GTP (UniProtKB | ChEBI) | ||||
Sequence: DVGGQ | ||||||
Binding site | 270-273 | GTP (UniProtKB | ChEBI) | ||||
Sequence: NKKD | ||||||
Binding site | 327 | GTP (UniProtKB | ChEBI) | ||||
Sequence: A |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | heterotrimeric G-protein complex | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | G-protein beta/gamma-subunit complex binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | metal ion binding | |
Biological Process | action potential | |
Biological Process | adenylate cyclase-modulating G protein-coupled receptor signaling pathway | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | phospholipase C-activating dopamine receptor signaling pathway |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGuanine nucleotide-binding protein subunit alpha-14
- Short namesG alpha-14; G-protein subunit alpha-14
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP30677
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000203753 | 1-355 | Guanine nucleotide-binding protein subunit alpha-14 | |||
Sequence: MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTALSRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 34-355 | G-alpha | ||||
Sequence: RELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYMCEQNKENAQIIREVEVDKVTALSRDQVAAIKQLWLDPGIQECYDRRREYQLSDSAKYYLTDIERIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFRTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV | ||||||
Region | 37-50 | G1 motif | ||||
Sequence: KLLLLGTGESGKST | ||||||
Region | 174-182 | G2 motif | ||||
Sequence: DVLRVRVPT | ||||||
Region | 197-206 | G3 motif | ||||
Sequence: FRMVDVGGQR | ||||||
Region | 266-273 | G4 motif | ||||
Sequence: ILFLNKKD | ||||||
Region | 325-330 | G5 motif | ||||
Sequence: TCATDT |
Sequence similarities
Belongs to the G-alpha family. G(q) subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length355
- Mass (Da)41,528
- Last updated2011-07-27 v2
- ChecksumD34B39ACD179AE82
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A494BBL5 | A0A494BBL5_MOUSE | Gna14 | 301 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 24-25 | in Ref. 1; AAA83222 | ||||
Sequence: QL → HV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M80631 EMBL· GenBank· DDBJ | AAA83222.1 EMBL· GenBank· DDBJ | mRNA | ||
AK160808 EMBL· GenBank· DDBJ | BAE36026.1 EMBL· GenBank· DDBJ | mRNA | ||
AK168498 EMBL· GenBank· DDBJ | BAE40384.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466534 EMBL· GenBank· DDBJ | EDL41541.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC027015 EMBL· GenBank· DDBJ | AAH27015.1 EMBL· GenBank· DDBJ | mRNA | ||
M57616 EMBL· GenBank· DDBJ | AAA63304.1 EMBL· GenBank· DDBJ | mRNA |