P30440 · FEL1B_FELCA
- ProteinMajor allergen I polypeptide chain 2
- GeneCH2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids109 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space |
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMajor allergen I polypeptide chain 2
- Alternative names
- Allergen nameFel d 1-B
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Feliformia > Felidae > Felinae > Felis
Accessions
- Primary accessionP30440
Proteomes
Subcellular Location
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human. Binds to IgE. Major allergen produced by the domestic cat. Implicated as an asthma-inducing agent in human. This protein is sticky and easily adheres to walls, carpet, clothing, furniture and bedding.
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 72 | in CH2LV | ||||
Sequence: I → L | ||||||
Natural variant | 72 | in CH2SV | ||||
Sequence: I → V | ||||||
Natural variant | 74-75 | in CH2SV | ||||
Sequence: RV → KF | ||||||
Natural variant | 91 | in CH2LV | ||||
Sequence: M → T | ||||||
Natural variant | 96 | in CH2SV | ||||
Sequence: Q → E | ||||||
Natural variant | 105 | in CH2SV | ||||
Sequence: N → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-17 | |||||
Sequence: MRGALLVLALLVTQALG | ||||||
Chain | PRO_0000021248 | 18-109 | Major allergen I polypeptide chain 2 | |||
Sequence: VKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR | ||||||
Disulfide bond | 24 | Interchain (with C-92 in chain 1) | ||||
Sequence: C | ||||||
Glycosylation | 50 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 65 | Interchain (with C-66 in chain 1) | ||||
Sequence: C | ||||||
Disulfide bond | 90 | Interchain (with C-25 in chain 1) | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
The long form is preferentially expressed in the salivary gland, while the short form is preferentially expressed in the skin.
Interaction
Subunit
Heterotetramer composed of two non-covalently linked disulfide-linked heterodimer of chains 1 and 2.
Structure
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing. Experimental confirmation may be lacking for some isoforms.
P30440-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsCH2L
- Length109
- Mass (Da)11,854
- Last updated1993-04-01 v1
- Checksum857FB9CD76036CB9
P30440-2
- Name2
- SynonymsCH2S
- Differences from canonical
- 82-89: TTISSSKD → IAINEY
P30440-3
- Name3
- SynonymsCH2ST, Truncated
- Differences from canonical
- 82-109: TTISSSKDCMGEAVQNTVEDLKLNTLGR → PSTNIAWVKQFRTP
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 24 | in Ref. 3; AA sequence | ||||
Sequence: C → F | ||||||
Sequence conflict | 32 | in Ref. 3; AA sequence | ||||
Sequence: F → T | ||||||
Alternative sequence | VSP_004249 | 82-89 | in isoform 2 | |||
Sequence: TTISSSKD → IAINEY | ||||||
Alternative sequence | VSP_004248 | 82-109 | in isoform 3 | |||
Sequence: TTISSSKDCMGEAVQNTVEDLKLNTLGR → PSTNIAWVKQFRTP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M77341 EMBL· GenBank· DDBJ | AAC41616.1 EMBL· GenBank· DDBJ | mRNA | ||
X62478 EMBL· GenBank· DDBJ | CAA44345.1 EMBL· GenBank· DDBJ | Genomic DNA |